Align malonate-semialdehyde dehydrogenase (acetylating) (EC 1.2.1.18) (characterized)
to candidate WP_090445819.1 BLS63_RS14555 betaine-aldehyde dehydrogenase
Query= reanno::pseudo5_N2C3_1:AO356_23175 (500 letters) >NCBI__GCF_900100495.1:WP_090445819.1 Length = 490 Score = 249 bits (637), Expect = 1e-70 Identities = 168/479 (35%), Positives = 253/479 (52%), Gaps = 17/479 (3%) Query: 10 YIDGR-IQASDNARLSNVFNPATGAVQARVALAEPSTVDAAVASALAAFPAWSEQSSLRR 68 YI GR + AS A V NPATG V ARV A + V+ AVASA A W+ ++++R Sbjct: 10 YIGGRYVPASSGASFETV-NPATGEVLARVQRASQADVERAVASAAAGQKVWAAMTAMQR 68 Query: 69 SRVMFKFKELLDRHHDELAQIISREHGKVLSDAHG-EVTRGIEIVEYACGAPNLLKTDFS 127 SR++ + E+L +DELA++ + + GK LS+ ++ G +++EY G ++ + Sbjct: 69 SRILRRAVEILRERNDELAELETLDTGKPLSETRFVDIVTGADVLEYYAGLVPAIEGE-Q 127 Query: 128 DNIGGGIDNWNLRQPLGVCAGVTPFNFPVMVPLWMIPLALVAGNCFILKPSERDPSASLL 187 + + R+PLGV AG+ +N+P+ + LW AL AGN I KPSE P + L Sbjct: 128 IPLRETSFVYTRREPLGVVAGIGAWNYPIQIALWKSAPALAAGNAMIFKPSEVTPLSVLK 187 Query: 188 MARLLTEAGLPDGVFNVVQGDKVAVDA-LLQHPDIEAISFVGSTPIAEYIHQQGTAQG-K 245 +A + +EAGLPDGVFNV+ G V L +HP IE ISF G T + + ++ K Sbjct: 188 LAEIYSEAGLPDGVFNVLTGSGREVGQWLTEHPGIEKISFTGGTSTGKKVMASASSSSLK 247 Query: 246 RVQALGGAKNHMIVMPDADLDQAADALIGAAYGSAGERCMAISIAVAVGDVGDELIAKLL 305 V G K+ +IV DADLD+AAD + A + S+G+ C + + AK+L Sbjct: 248 EVTMELGGKSPLIVFEDADLDRAADIAVMANFYSSGQVCTNGTRVFVPRMLQARFEAKVL 307 Query: 306 PRIDQLKIGNGQQPGTDMGPLVTAEHKAKVEGFIDAGVAEGARLIVDGRGFKVPGAEQGF 365 R+ ++++G+ Q T+ GPLV+ H V G+ID G EGARL++ G +G Sbjct: 308 ERVKRIRLGDPQDANTNFGPLVSFAHMESVLGYIDKGRQEGARLLIGGARVTDGEYAKGA 367 Query: 366 FVGATLFDQVTAEMSIYQQEIFGPVLGIVRVPDFATAVALINAHEFGNGVSCFTRDGGIA 425 +V T+F + EM I ++EIFGPV+ I+ + N ++G TRD A Sbjct: 368 YVAPTVFTDCSDEMCIVREEIFGPVMSILVYDSEDEVIRRANDSDYGLAAGVVTRDLARA 427 Query: 426 RAFARSIKVGMVGINV----PIPVPMAWHSFGGWKRSLFGDHHAYGEEGLRFYSRYKSV 480 ++ G+ IN P +P+ GG+K+S G + G L Y+R KSV Sbjct: 428 HRVIHKLEAGICWINTWGESPAEMPV-----GGYKQSGVGREN--GLTTLAHYTRIKSV 479 Lambda K H 0.320 0.137 0.412 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 503 Number of extensions: 32 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 500 Length of database: 490 Length adjustment: 34 Effective length of query: 466 Effective length of database: 456 Effective search space: 212496 Effective search space used: 212496 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory