Align subunit of 3-oxoadipate enol-lactone hydrolase (EC 3.1.1.24) (characterized)
to candidate WP_090446251.1 BLS63_RS15525 alpha/beta hydrolase
Query= metacyc::MONOMER-3221 (263 letters) >NCBI__GCF_900100495.1:WP_090446251.1 Length = 267 Score = 73.6 bits (179), Expect = 4e-18 Identities = 59/194 (30%), Positives = 82/194 (42%), Gaps = 5/194 (2%) Query: 24 LVLSNSLGTDLGMWDTQIPLWSQHFRVLRYDTRGHGASLVTEGPYSIEQLGRDVLALLDG 83 +VL + LG+ W QI S+ V D RGHGAS P S+ +L DV + Sbjct: 28 VVLLHGLGSSWQDWQPQIEALSRFAEVFALDLRGHGASEPLRAPVSLVELAADVAEFIRA 87 Query: 84 LDIQKAHFVGLSMGGLIGQWLGIHAGERLHSLTLCNTAAKIANDEVWNTRIDTVLKGGQQ 143 L +Q VG+SMGG++G L + L N+A D W R +L+ Sbjct: 88 LGLQGCVLVGVSMGGMLGFQLLASQPGLVGGLVAINSAPSFPLDS-WALRSQVLLRLALI 146 Query: 144 AMVDLRDAS--IARWFTPGFAQAQAEQAQRICQMLAQTSPQGYAGNCAAVRDADYREQLG 201 ++ LR +AR P QAE +R Q + Y A+ L Sbjct: 147 RLLGLRTLGRLLARKLFP--HAGQAELRRRTAQRIGANDRASYLFAIRAILGWSALPALN 204 Query: 202 RIQVPALIVAGTQD 215 R+ P LIVAG +D Sbjct: 205 RVDTPMLIVAGDRD 218 Lambda K H 0.321 0.137 0.416 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 156 Number of extensions: 10 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 263 Length of database: 267 Length adjustment: 25 Effective length of query: 238 Effective length of database: 242 Effective search space: 57596 Effective search space used: 57596 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory