Align glutaminase (EC 3.5.1.2) (characterized)
to candidate WP_090446345.1 BLS63_RS15665 glutaminase
Query= BRENDA::P0A6W0 (308 letters) >NCBI__GCF_900100495.1:WP_090446345.1 Length = 302 Score = 373 bits (957), Expect = e-108 Identities = 188/301 (62%), Positives = 236/301 (78%), Gaps = 1/301 (0%) Query: 8 AILENILRQVRPLIGQGKVADYIPALATVDGSRLGIAICTVDGQLFQAGDAQERFSIQSI 67 A+L IL +VRPLIG+GKVADYIPALA V +LGIA+ DG+L AGDA+ FSIQSI Sbjct: 3 ALLNEILDEVRPLIGRGKVADYIPALADVPPDQLGIAVYGNDGELHVAGDARTAFSIQSI 62 Query: 68 SKVLSLVVAMRHYSEEEIWQRVGKDPSGSPFNSLVQLEMEQGIPRNPFINAGALVVCDML 127 SKV SLV A+ H S E+IWQR+G +PSG PFNSLVQLE E+G PRNPFINAGALV+CD+ Sbjct: 63 SKVFSLVQAIGH-SGEDIWQRLGHEPSGQPFNSLVQLEFERGRPRNPFINAGALVICDIN 121 Query: 128 QGRLSAPRQRMLEVVRGLSGVSDISYDTVVARSEFEHSARNAAIAWLMKSFGNFHHDVTT 187 Q R +AP M + VR LSG +++ D VA SE++H ARNAA+A+LM++FGNFH+DV Sbjct: 122 QSRFAAPALSMRDFVRRLSGNPELASDARVAESEYQHRARNAAMAYLMQAFGNFHNDVEA 181 Query: 188 VLQNYFHYCALKMSCVELARTFVFLANQGKAIHIDEPVVTPMQARQINALMATSGMYQNA 247 VL++YF +CAL+MSCV+LAR F FLAN G H E ++TP Q +Q+NA+MATSG+Y A Sbjct: 182 VLRSYFSHCALRMSCVDLARAFCFLANDGFCKHSGERILTPRQTKQVNAIMATSGLYDEA 241 Query: 248 GEFAWRVGLPAKSGVGGGIVAIVPHEMAIAVWSPELDDAGNSLAGIAVLEQLTKQLGRSV 307 G FA+RVGLP KSGVGGGIVA+VP ++ VWSPEL+ AGNSLAG+A LE L++++G SV Sbjct: 242 GNFAYRVGLPGKSGVGGGIVAVVPGRFSVCVWSPELNAAGNSLAGMAALESLSQRIGWSV 301 Query: 308 Y 308 + Sbjct: 302 F 302 Lambda K H 0.321 0.135 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 325 Number of extensions: 15 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 308 Length of database: 302 Length adjustment: 27 Effective length of query: 281 Effective length of database: 275 Effective search space: 77275 Effective search space used: 77275 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory