Align Putrescine transport system permease protein PotI (characterized)
to candidate WP_090446354.1 BLS63_RS15730 ABC transporter permease
Query= SwissProt::P0AFL1 (281 letters) >NCBI__GCF_900100495.1:WP_090446354.1 Length = 275 Score = 150 bits (380), Expect = 2e-41 Identities = 91/251 (36%), Positives = 138/251 (54%), Gaps = 8/251 (3%) Query: 22 FLYAPMLMLVIYSFNSSK-LVTVWAGWSTRWYGELLRDDAMMSAVGLSLTIAACAATAAA 80 FL P+L+++ SFNS LV G+S RWY + M ++ SL IA A T A Sbjct: 27 FLILPVLVIIPLSFNSGTFLVYPLQGFSLRWYEDFFMSADWMRSLKNSLIIAPAATTLAM 86 Query: 81 ILGTIAAVVLVRFGRFRGSNGFAFMITAPLVMPDVITGLSLLLLFVALAHAIGWPADRGM 140 + GT+AA+ L R G FRG ++ +P+V+P VI G++ L F L + Sbjct: 87 VFGTLAAIGLTR-GEFRGKALVMSLLISPMVVPVVIIGVASYLFFAPLGFGNSY------ 139 Query: 141 LTIWLAHVTFCTAYVAVVISSRLRELDRSIEEAAMDLGATPLKVFFVITLPMIMPAIISG 200 L + L H +V + +S+ L+ + ++ AA LGA PL F +TLP+I P +ISG Sbjct: 140 LALILVHAVLGVPFVIITVSATLQGFNHNLVRAAASLGAAPLTAFRRVTLPLIAPGVISG 199 Query: 201 WLLAFTLSLDDLVIASFVSGPGATTLPMLVFSSVRMGVNPEINALATLILGAVGIVGFIA 260 L AF S D++V+ F++GP TLP +FS +R ++P I A+ATL++G ++ Sbjct: 200 ALFAFATSFDEVVVTLFLAGPEQVTLPRQMFSGIRENLSPTIAAVATLLIGFSILLLLTL 259 Query: 261 WYLMARAEKQR 271 +L R+EK R Sbjct: 260 EWLRGRSEKLR 270 Lambda K H 0.330 0.140 0.430 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 223 Number of extensions: 14 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 281 Length of database: 275 Length adjustment: 25 Effective length of query: 256 Effective length of database: 250 Effective search space: 64000 Effective search space used: 64000 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory