Align 4-hydroxybenzoate transporter PcaK (characterized)
to candidate WP_090446579.1 BLS63_RS16340 3-(3-hydroxy-phenyl)propionate transporter MhpT
Query= SwissProt::Q51955 (448 letters) >NCBI__GCF_900100495.1:WP_090446579.1 Length = 408 Score = 212 bits (540), Expect = 2e-59 Identities = 139/406 (34%), Positives = 202/406 (49%), Gaps = 34/406 (8%) Query: 31 VLLCFLIVFLDGLDTAAMGFIAPALSQEWGIDRASLGPVMSAALIGMVFGALGSGPLADR 90 ++LCF++ ++G D A G AP ++ +G+ LG + S L+G++ GAL G LADR Sbjct: 16 IVLCFMVALIEGFDLQAAGIAAPHIAMAFGLTPVQLGWLFSVGLLGLLPGALVGGWLADR 75 Query: 91 FGRKGVLVGAVLVFGGFSLASAYATNVDQLLVLRFLTGLGLGAGMPNATTLLSEYTPERL 150 GRK VL+ AVL+FGGFSL +A+A + LL+ R TGLGLGA +P L SE +L Sbjct: 76 LGRKAVLIAAVLLFGGFSLLTAHAGSYASLLLARLATGLGLGAALPILIALSSEVADAQL 135 Query: 151 KSLLVTSMFCGFNLGMAGGGFISAKMIPAYGWHSLLVIGGVLPLLLALVLMVWLPESARF 210 K + V+ +CG LG A + W + +GGV P+L+A +L + L ES Sbjct: 136 KGIAVSLTYCGVPLGGAMAALTGVLGVGG-DWRLIFYLGGVAPILVAGLLALLLRES--- 191 Query: 211 LVVRNRGTDKIRKTLSPIAPQVVAEAGSFSVPEQKAVAARSVFAVIFSGTYGLGTMLLWL 270 VV +AG A S + +F+ T+L+WL Sbjct: 192 --------------------PVVRQAG--------AAGPESAISGLFARGRATATLLIWL 223 Query: 271 TYFMGLVIVYLLTSWLPTLMRDSGASMEQAAFIGALFQFGGVLSAVGVGWAMDRYNPHKV 330 + F L ++Y+L +WLP+L+ G QA ++ LF GG +V GW +DR P + Sbjct: 224 SSFFTLAVLYMLLNWLPSLLAALGYDRVQAGYVQILFNIGGAAGSVLTGWLLDRGRPVLL 283 Query: 331 IGIFYLLAGVFAYAVGQSLGNITVLATLVLIAGMCVNGAQSAMPSLAARFYPTQGRATGV 390 + YL VF A+G + +L AG C GAQ + +LA YP + RATGV Sbjct: 284 VLGTYLGMLVFLAALG-LVQRFDLLLLAGAGAGFCAIGAQLLLYALAPGLYPARIRATGV 342 Query: 391 SWMLGIGRFGAILGAWSGATLLGLGWNFEQVLTALLVPAALATVGV 436 + GR G++ G +L LG VL A P L + G+ Sbjct: 343 GATVAAGRLGSMAGPLVAGQVLALGLGGSAVLLA-AAPGLLLSAGM 387 Lambda K H 0.325 0.140 0.424 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 542 Number of extensions: 33 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 448 Length of database: 408 Length adjustment: 32 Effective length of query: 416 Effective length of database: 376 Effective search space: 156416 Effective search space used: 156416 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory