Align Putrescine-binding periplasmic protein SpuD (characterized)
to candidate WP_090446698.1 BLS63_RS16655 polyamine ABC transporter substrate-binding protein
Query= SwissProt::Q02UB7 (367 letters) >NCBI__GCF_900100495.1:WP_090446698.1 Length = 364 Score = 530 bits (1366), Expect = e-155 Identities = 256/366 (69%), Positives = 307/366 (83%), Gaps = 2/366 (0%) Query: 2 MKRFGKTLLALTLAGSVAGMAQAADNKVLHVYNWSDYIAPDTLEKFTKETGIKVVYDVYD 61 MK FGKTLLAL+LAG+VAG AQA + KVLHVYNWSDYIA DTLE F K TGIKVVYDV+D Sbjct: 1 MKTFGKTLLALSLAGAVAGAAQAQE-KVLHVYNWSDYIAEDTLENFQKATGIKVVYDVFD 59 Query: 62 SNEVLEAKLLAGKSGYDVVVPSNSFLAKQIKAGVYQKLDKSKLPNWKNLNKDLMHTLEVS 121 SNE LEAKLL+G SGYDVVVPSN FLAKQIKAGV+Q LDKSKLPNWKNLN DLM LE + Sbjct: 60 SNETLEAKLLSGGSGYDVVVPSNQFLAKQIKAGVFQPLDKSKLPNWKNLNPDLMKALENA 119 Query: 122 DPGNEHAIPYMWGTIGIGYNPDKVKAAFGDNAPVDSWDLVFKPENIQKLKQCGVSFLDSP 181 DPGN++A PY+WGT GIGYNP+KVKAA G + +DSWD++FKPEN++KLK CGVS LD+P Sbjct: 120 DPGNKYAFPYLWGTTGIGYNPEKVKAALGVDT-IDSWDVLFKPENMEKLKSCGVSMLDAP 178 Query: 182 TEILPAALHYLGYKPDTDNPKELKAAEELFLKIRPYVTYFHSSKYISDLANGNICVAIGY 241 EI AALHY G P+ + +++ AEEL +K+RPY+TYFHSSKYISDLANG+ICVA+G+ Sbjct: 179 DEIYAAALHYQGLNPNPTSVEDVAKAEELLMKVRPYITYFHSSKYISDLANGDICVALGW 238 Query: 242 SGDIYQAKSRAEEAKNKVTVKYNIPKEGAGSFFDMVAIPKDAENTEGALAFVNFLMKPEI 301 SGDI+QA++RAEEAKN V V Y IPKEGA +FFDM+AIP DA+N E A F+N+++ PE+ Sbjct: 239 SGDIFQAQARAEEAKNNVPVAYTIPKEGAATFFDMMAIPADAKNVEEAHVFLNYILTPEV 298 Query: 302 MAEITDVVQFPNGNAAATPLVSEAIRNDPGIYPSEEVMKKLYTFPDLPAKTQRAMTRSWT 361 +A I+D V +PNGN+AATPLVSE +RN+PGIYP+E KKLYTF +L QRA+TRSWT Sbjct: 299 IAPISDYVAYPNGNSAATPLVSEEVRNNPGIYPTEAASKKLYTFAELTPAVQRAITRSWT 358 Query: 362 KIKSGK 367 K+KSG+ Sbjct: 359 KVKSGR 364 Lambda K H 0.315 0.133 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 559 Number of extensions: 17 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 367 Length of database: 364 Length adjustment: 30 Effective length of query: 337 Effective length of database: 334 Effective search space: 112558 Effective search space used: 112558 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory