Align N-carbamoylputrescine amidase; Nitrilase-like protein 1; EC 3.5.1.53 (characterized)
to candidate WP_090446709.1 BLS63_RS16685 N-carbamoylputrescine amidase
Query= SwissProt::Q8VYF5 (299 letters) >NCBI__GCF_900100495.1:WP_090446709.1 Length = 292 Score = 371 bits (953), Expect = e-108 Identities = 182/292 (62%), Positives = 224/292 (76%), Gaps = 4/292 (1%) Query: 8 REVVVSSLQFACSDDISTNVAAAERLVREAHAKGANIILIQELFEGYYFCQAQREDFFKR 67 R V V++ Q ACS D + N+A AE+LVR+A A+GA IILIQELFE YFCQ D+ + Sbjct: 3 RIVTVAATQMACSWDRAGNIANAEKLVRQAAAQGAQIILIQELFETPYFCQKPNPDYLQL 62 Query: 68 AKPYKNHPTIARMQKLAKELGVVIPVSFFEEANTAHYNSIAIIDADGTDLGIYRKSHIPD 127 A P +++ IA QK+AKEL VV+P+SFFE A A +NS+AIIDADG +LGIYRKSHIPD Sbjct: 63 ATPVESNAAIAHFQKVAKELQVVLPISFFELAGRARFNSVAIIDADGKNLGIYRKSHIPD 122 Query: 128 GPGYQEKFYFNPGDTGFKVFQTKFAKIGVAICWDQWFPEAARAMVLQGAEILFYPTAIGS 187 GPGY EK+YFNPGDTGFKV+ T++AKIGV ICWDQWFPE AR+M L GAEILFYPTAIG+ Sbjct: 123 GPGYHEKYYFNPGDTGFKVWNTRYAKIGVGICWDQWFPETARSMALLGAEILFYPTAIGT 182 Query: 188 EPQDQGLDSRDHWRRVMQGHAGANVVPLVASNRIGKEIIETEHGPSQITFYGTSFIAGPT 247 EP D + SRDHW+RV QGHAGAN++PLVASNRIG+E + G I FYG+SFIA Sbjct: 183 EPHDPTITSRDHWQRVQQGHAGANLMPLVASNRIGRE----DQGDYHIDFYGSSFIADQF 238 Query: 248 GEIVAEADDKSEAVLVAQFDLDMIKSKRQSWGVFRDRRPDLYKVLLTMDGNL 299 G+ V E ++ E VLV +FDLD ++ R +WG FRDRRP+LY + T+DG+L Sbjct: 239 GKKVEELNETEEGVLVHRFDLDQLEHTRSAWGSFRDRRPNLYGPIKTLDGSL 290 Lambda K H 0.321 0.137 0.410 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 304 Number of extensions: 5 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 299 Length of database: 292 Length adjustment: 26 Effective length of query: 273 Effective length of database: 266 Effective search space: 72618 Effective search space used: 72618 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
Align candidate WP_090446709.1 BLS63_RS16685 (N-carbamoylputrescine amidase)
to HMM TIGR03381 (aguB: N-carbamoylputrescine amidase (EC 3.5.1.53))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR03381.hmm # target sequence database: /tmp/gapView.24792.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR03381 [M=279] Accession: TIGR03381 Description: agmatine_aguB: N-carbamoylputrescine amidase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.1e-148 478.1 0.0 4.7e-148 478.0 0.0 1.0 1 lcl|NCBI__GCF_900100495.1:WP_090446709.1 BLS63_RS16685 N-carbamoylputresc Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_900100495.1:WP_090446709.1 BLS63_RS16685 N-carbamoylputrescine amidase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 478.0 0.0 4.7e-148 4.7e-148 1 278 [. 5 282 .. 5 283 .. 0.99 Alignments for each domain: == domain 1 score: 478.0 bits; conditional E-value: 4.7e-148 TIGR03381 1 vkvaavqlalsedveeniekaeklvreaaakGaqiillpelfeapyfckeqeeeyfelakpveehplik 69 v+vaa+q+a+s+d + ni++aeklvr+aaa+Gaqiil++elfe+pyfc++ + +y++la+pve++++i+ lcl|NCBI__GCF_900100495.1:WP_090446709.1 5 VTVAATQMACSWDRAGNIANAEKLVRQAAAQGAQIILIQELFETPYFCQKPNPDYLQLATPVESNAAIA 73 79******************************************************************* PP TIGR03381 70 rlqklakelevvlpvsffekagnalynslavidadGevlgvyrkshiPdgpgyeekfyfkpGdtGfkvw 138 ++qk+akel+vvlp+sffe ag+a++ns+a+idadG++lg+yrkshiPdgpgy+ek+yf+pGdtGfkvw lcl|NCBI__GCF_900100495.1:WP_090446709.1 74 HFQKVAKELQVVLPISFFELAGRARFNSVAIIDADGKNLGIYRKSHIPDGPGYHEKYYFNPGDTGFKVW 142 ********************************************************************* PP TIGR03381 139 dtryakiGvgicWdqWfpeaaralalkGaevllyPtaiGsePadaeldskehWqramqGhaaanvvpvv 207 +tryakiGvgicWdqWfpe+ar++al Gae+l+yPtaiG+eP+d+++ s++hWqr++qGha an++p+v lcl|NCBI__GCF_900100495.1:WP_090446709.1 143 NTRYAKIGVGICWDQWFPETARSMALLGAEILFYPTAIGTEPHDPTITSRDHWQRVQQGHAGANLMPLV 211 ********************************************************************* PP TIGR03381 208 aanrigkeveaeleltfyGssfiadetGelvaeadrseeavlvaefdldeiakeraawGlfrdrrpely 276 a+nrig+e + +++++fyGssfiad+ G++v+e++++ee+vlv++fdld+++++r+awG frdrrp+ly lcl|NCBI__GCF_900100495.1:WP_090446709.1 212 ASNRIGREDQGDYHIDFYGSSFIADQFGKKVEELNETEEGVLVHRFDLDQLEHTRSAWGSFRDRRPNLY 280 ********************************************************************* PP TIGR03381 277 ek 278 lcl|NCBI__GCF_900100495.1:WP_090446709.1 281 GP 282 86 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (279 nodes) Target sequences: 1 (292 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 7.54 // [ok]
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory