Align 4-oxalocrotonate decarboxylase subunit (EC 4.1.1.77) (characterized)
to candidate WP_090446859.1 BLS63_RS17005 2-keto-4-pentenoate hydratase
Query= metacyc::MONOMER-12752 (264 letters) >NCBI__GCF_900100495.1:WP_090446859.1 Length = 266 Score = 171 bits (434), Expect = 1e-47 Identities = 96/257 (37%), Positives = 144/257 (56%) Query: 8 EQVLALAEHIENAELQAHDIHKVTNDYPEMTFADAYTIQWEIRRRKEERGNKIVGLKMGL 67 EQ+ A A + A I +++ + + ADAY +Q +R G ++VG K+GL Sbjct: 10 EQIEAAALALRAARTGQAPIAQISATFGIDSLADAYAVQELNTQRALTDGRRLVGRKVGL 69 Query: 68 TSWAKMAQMGVETPIYGFLADYFSVPDGGVVDCSKLIHPKIEAEIAVVTKAPLVGPGCHI 127 TS A Q+GV+ P +G L + D G +DCS+LI PK E EIA V L + Sbjct: 70 TSSAVQQQLGVDQPDFGMLFADMEILDDGEIDCSRLIQPKAEGEIAFVLDRDLPNADTTL 129 Query: 128 GDVIAAVDYVIPTVEVIDSRYENFKFDLISVVADNASSTRYITGGRMANLEDVDLRTLGV 187 ++I+AV Y++P +E++DS ++K L+ VADNASS Y+ G + L +DLR G+ Sbjct: 130 AELISAVGYLLPAIEIVDSAIADWKITLVDTVADNASSALYVLGKQPIKLSALDLRLEGM 189 Query: 188 VMEKNGEVVELGAGAAVLGHPLSSVAMLANLLAERGEHIPAGTFIMTGGITAAVAVAPGD 247 ++EKN + LG GAA LG+PL + LA +AE G + AG +++G + V GD Sbjct: 190 LLEKNRALASLGVGAACLGNPLDACLWLARTMAEIGRPLHAGDVLLSGALGPMTPVVAGD 249 Query: 248 NITVRYQGLGSVSARFV 264 ++ +R LG V RFV Sbjct: 250 HLHLRLTRLGEVGCRFV 266 Lambda K H 0.319 0.136 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 161 Number of extensions: 6 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 264 Length of database: 266 Length adjustment: 25 Effective length of query: 239 Effective length of database: 241 Effective search space: 57599 Effective search space used: 57599 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory