Align ABC transporter for D-Galactose and D-Glucose, permease component 2 (characterized)
to candidate WP_090447187.1 BLS63_RS18130 carbohydrate ABC transporter permease
Query= reanno::pseudo13_GW456_L13:PfGW456L13_1896 (281 letters) >NCBI__GCF_900100495.1:WP_090447187.1 Length = 278 Score = 496 bits (1278), Expect = e-145 Identities = 243/275 (88%), Positives = 260/275 (94%) Query: 7 KSGISFSRIAIYATLLLAAAVYLIPLVVMLLTSFKSPEDIRTGNLLSWPTVIDGIGWIKA 66 +S +S SR+AIYATLL A AVYLIPLVVMLLTSFKSP+DIRTGNLLSWP VI IGW+KA Sbjct: 4 RSPLSLSRLAIYATLLAACAVYLIPLVVMLLTSFKSPDDIRTGNLLSWPDVITAIGWLKA 63 Query: 67 WDVVGGYFWNSVKITVPAVLISTFIGAMNGYVLSMWRFRGSQLFFGLLLFGCFLPFQTVL 126 WD VGG+FWNSVKITVPAVLIST +GA+NGYVL+MWRFRGSQLFFGLLLFGCFLPFQ VL Sbjct: 64 WDSVGGFFWNSVKITVPAVLISTLLGALNGYVLAMWRFRGSQLFFGLLLFGCFLPFQVVL 123 Query: 127 LPASFTLGKFGLANTTTGLVLVHVVYGLAFTTLFFRNYYVSIPDALVKAARLDGAGFFTI 186 LPASFTLG+ GLANTT+GLVLVHVVYGLAFTTLFFRNYYVS+PDALV+AARLDGAGFFTI Sbjct: 124 LPASFTLGQLGLANTTSGLVLVHVVYGLAFTTLFFRNYYVSVPDALVRAARLDGAGFFTI 183 Query: 187 FLKILLPMSIPIVMVCLIWQFTQIWNDFLFGVVFASGDAQPITVALNNLVNTSTGAKEYN 246 F +ILLPMSIPI+MVCLIWQFTQIWNDFLFGVVFASGD QPITVALNNLVNTSTG KEYN Sbjct: 184 FGRILLPMSIPIIMVCLIWQFTQIWNDFLFGVVFASGDTQPITVALNNLVNTSTGVKEYN 243 Query: 247 VDMAAAMIAGLPTLLVYIFAGKYFLRGLTSGAVKG 281 VDMAAAMIAGLPTL+VYI AGKYFLRGLT+GAVKG Sbjct: 244 VDMAAAMIAGLPTLVVYILAGKYFLRGLTAGAVKG 278 Lambda K H 0.329 0.143 0.447 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 371 Number of extensions: 6 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 281 Length of database: 278 Length adjustment: 26 Effective length of query: 255 Effective length of database: 252 Effective search space: 64260 Effective search space used: 64260 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory