Align Glucokinase (EC 2.7.1.2) (characterized)
to candidate WP_090447192.1 BLS63_RS18155 glucokinase
Query= reanno::WCS417:GFF4431 (318 letters) >NCBI__GCF_900100495.1:WP_090447192.1 Length = 320 Score = 449 bits (1156), Expect = e-131 Identities = 220/316 (69%), Positives = 251/316 (79%) Query: 1 MKLALVGDIGGTNARFALWRDQELHSIRVHATADHSSPEDAIKVYLKEEGLEIGDIGAVC 60 M LALVGDIGGTNARFALWRDQ+L S+RV ATAD+ PE AI+ YL E GL +G + +VC Sbjct: 1 MNLALVGDIGGTNARFALWRDQQLESVRVLATADYPGPEQAIRAYLNELGLPLGAVDSVC 60 Query: 61 LSVAGPVSGDEFKFTNNHWRLSKTAFCKTLQVDELLLVNDFSAMALGMTRLKPDEFRVVC 120 L+ AGPV+GD F+FTNNHWR+S+ AFC+ LQV ELLLVNDFSAMALGMTRL+ DE R+VC Sbjct: 61 LACAGPVNGDLFRFTNNHWRISREAFCRELQVRELLLVNDFSAMALGMTRLRDDERRLVC 120 Query: 121 EGTPEPLRPAVVIGPGTGLGVGTLLDLGAGRFAALPGEGGHVDLPLSSPRETQLWQHIYT 180 G E RP VVIGPGTGLGVGTLL L G + ALPGEGGHVDLP+ SPRE +LWQ +Y Sbjct: 121 PGVAEADRPCVVIGPGTGLGVGTLLQLADGSWLALPGEGGHVDLPIGSPREARLWQQLYA 180 Query: 181 EIGHVSAETALSGGGLPRLYRAICAVDGHTPVLETPEAITAAGLAGDPVAMEVLDQFSIW 240 ++GHV AE LSG GL LYRAICA+DGH L P +TAA LAGD VA+ VL+QF W Sbjct: 181 QLGHVRAEDVLSGSGLLLLYRAICALDGHEVRLNAPAEVTAAALAGDEVALAVLEQFCCW 240 Query: 241 LGRVAGNNVLTTGGRGGVYIVGGVIPRFADFFINSGFAKSFADKGCMSDYFKGIPVWLVT 300 LGR AGNNVL+ G RGGVYIVGGV+PRFA+ F+ SGFA+ DKG MSDYF GIPVWLVT Sbjct: 241 LGRAAGNNVLSLGARGGVYIVGGVVPRFAELFLASGFARCLRDKGRMSDYFDGIPVWLVT 300 Query: 301 APYSGLTGAGVALEQA 316 A Y GL GAGVAL+QA Sbjct: 301 AEYPGLMGAGVALQQA 316 Lambda K H 0.320 0.139 0.429 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 361 Number of extensions: 7 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 318 Length of database: 320 Length adjustment: 28 Effective length of query: 290 Effective length of database: 292 Effective search space: 84680 Effective search space used: 84680 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
Align candidate WP_090447192.1 BLS63_RS18155 (glucokinase)
to HMM TIGR00749 (glk: glucokinase (EC 2.7.1.2))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR00749.hmm # target sequence database: /tmp/gapView.16609.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00749 [M=315] Accession: TIGR00749 Description: glk: glucokinase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.7e-86 275.2 0.0 4.3e-86 275.0 0.0 1.0 1 lcl|NCBI__GCF_900100495.1:WP_090447192.1 BLS63_RS18155 glucokinase Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_900100495.1:WP_090447192.1 BLS63_RS18155 glucokinase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 275.0 0.0 4.3e-86 4.3e-86 1 315 [] 5 310 .. 5 310 .. 0.97 Alignments for each domain: == domain 1 score: 275.0 bits; conditional E-value: 4.3e-86 TIGR00749 1 lvgdiGGtnarlalvevapgeieqvktyssedfpsleavvrvyleeakvelkdpikgcfaiatPiigdf 69 lvgdiGGtnar+al +++e+v+++ + d+p e+++r yl+e l+ c+a a+P+ gd+ lcl|NCBI__GCF_900100495.1:WP_090447192.1 5 LVGDIGGTNARFAL--WRDQQLESVRVLATADYPGPEQAIRAYLNELGLPLGAVDSVCLACAGPVNGDL 71 89************..8999********************************97799************ PP TIGR00749 70 vrltnldWalsieelkqelalaklelindfaavayailalkeedliqlggakveesaaiailGaGtGlG 138 r+tn++W +s e +el +++l l+ndf+a+a++++ l++++ + +e + + ++G+GtGlG lcl|NCBI__GCF_900100495.1:WP_090447192.1 72 FRFTNNHWRISREAFCRELQVRELLLVNDFSAMALGMTRLRDDERRLVCPGVAEADRPCVVIGPGTGLG 140 *****************************************999888888888999************* PP TIGR00749 139 vatliqqsdgrykvlageGghvdfaPrseleillleylrkkygrvsaervlsGsGlvliyealskrkge 207 v tl+q +dg++ +l+geGghvd+ s+ e+ l++ l +++g+v ae vlsGsGl l+y+a+ +g+ lcl|NCBI__GCF_900100495.1:WP_090447192.1 141 VGTLLQLADGSWLALPGEGGHVDLPIGSPREARLWQQLYAQLGHVRAEDVLSGSGLLLLYRAICALDGH 209 *****************************************************************9976 PP TIGR00749 208 revsklskeelkekdiseaalegsdvlarralelflsilGalagnlalklgarGGvyvaGGivPrfiel 276 + +l+ + +++ aal+g++v a le f+ lG+ agn l lgarGGvy++GG+vPrf el lcl|NCBI__GCF_900100495.1:WP_090447192.1 210 E--VRLN----APAEVTAAALAGDEV-ALAVLEQFCCWLGRAAGNNVLSLGARGGVYIVGGVVPRFAEL 271 5..4665....899*********986.6679************************************** PP TIGR00749 277 lkkssfraafedkGrlkellasiPvqvvlkkkvGllGag 315 + +s+f + dkGr+ +++ iPv +v + +Gl+Gag lcl|NCBI__GCF_900100495.1:WP_090447192.1 272 FLASGFARCLRDKGRMSDYFDGIPVWLVTAEYPGLMGAG 310 *************************************97 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (315 nodes) Target sequences: 1 (320 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.01s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 6.50 // [ok]
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory