Align 2,3-dehydroadipyl-CoA hydratase (EC 4.2.1.17) (characterized)
to candidate WP_090447208.1 BLS63_RS18235 enoyl-CoA hydratase
Query= metacyc::MONOMER-15953 (257 letters) >NCBI__GCF_900100495.1:WP_090447208.1 Length = 263 Score = 129 bits (324), Expect = 6e-35 Identities = 88/256 (34%), Positives = 124/256 (48%), Gaps = 21/256 (8%) Query: 14 VRLITLQRPEALNALNTQLLDELAAELALAEQDAETRAVVLTGSRKAFAAGADIKEMAER 73 + LI L R NA + +LD+L E+D E R ++ + F+AG D+ ++A R Sbjct: 17 IMLIGLDRAAKRNAFDLDMLDDLCLAYGEFERDGEARVALIHAHGEHFSAGLDLAKVATR 76 Query: 74 ------------DLVGILEDPRVAHWQRIAAFSKPLIAAVNGFCLGGGCELAMHADILIA 121 D G+ PRV SKP+I A G+C G EL + +DI + Sbjct: 77 FAAGWTIPAGGCDPWGVFGGPRV---------SKPVIVAAQGYCYTIGIELMLASDINLC 127 Query: 122 GEDARFGQPEINLGIMPGAGGTQRLLRAVGKSLAMQMVLSGQAIDARHAQRAGLVSEVTL 181 + RF Q E+ GI P G T RL +A G AM+ +L+G DA A R GLV EV Sbjct: 128 ASNTRFAQMEVQRGIFPFGGATLRLQQAAGWGNAMRWLLTGDEFDAHEAYRLGLVQEVLA 187 Query: 182 PELTIERALAIARVIAQKAPLAVRLAKEALLKAEDTDLASGLRFERHAFTVLAGTADRAE 241 E + RAL +A IA +APL V+ + +A A+ + T L +AD E Sbjct: 188 SEELLPRALKLAERIAAQAPLGVQATLASARQALREGEAAAAANLQPTVTRLMASADAQE 247 Query: 242 GIRAFQEKRRPEFTGR 257 G+RA E+R +F GR Sbjct: 248 GLRAMLERRPGDFQGR 263 Lambda K H 0.320 0.134 0.374 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 146 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 257 Length of database: 263 Length adjustment: 24 Effective length of query: 233 Effective length of database: 239 Effective search space: 55687 Effective search space used: 55687 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory