Align Putrescine-binding periplasmic protein SpuD (characterized)
to candidate WP_090447267.1 BLS63_RS18515 polyamine ABC transporter substrate-binding protein
Query= SwissProt::Q02UB7 (367 letters) >NCBI__GCF_900100495.1:WP_090447267.1 Length = 371 Score = 399 bits (1024), Expect = e-116 Identities = 189/362 (52%), Positives = 264/362 (72%), Gaps = 1/362 (0%) Query: 6 GKTLLALTL-AGSVAGMAQAADNKVLHVYNWSDYIAPDTLEKFTKETGIKVVYDVYDSNE 64 G TLL L A +++ A + L VYNW+DY+ P ++F +++GI++ +DV+D+NE Sbjct: 9 GSTLLGAALCAATLSTTAAQPPMRELRVYNWADYMLPSVPKEFQQKSGIQLTWDVFDTNE 68 Query: 65 VLEAKLLAGKSGYDVVVPSNSFLAKQIKAGVYQKLDKSKLPNWKNLNKDLMHTLEVSDPG 124 LEAKLL G SGYD+VVP+N+FL QIKAGV+QKLDK+KLPNW++L+ L+ + +DPG Sbjct: 69 ALEAKLLTGNSGYDLVVPTNTFLDTQIKAGVFQKLDKAKLPNWQHLDPGLLQLMTANDPG 128 Query: 125 NEHAIPYMWGTIGIGYNPDKVKAAFGDNAPVDSWDLVFKPENIQKLKQCGVSFLDSPTEI 184 N++A+PYM+GT+ IG+NP KVKA GD+APVDSW+L+F ENI KL+QCGV+ LDSP +I Sbjct: 129 NQYAVPYMYGTVLIGFNPAKVKAVLGDDAPVDSWELIFNEENIAKLQQCGVAMLDSPGDI 188 Query: 185 LPAALHYLGYKPDTDNPKELKAAEELFLKIRPYVTYFHSSKYISDLANGNICVAIGYSGD 244 LP ALH+LG P++ ++ + A+ L LKIRPY+ YFHS+KY++D+ANG+ICVAIGYSG Sbjct: 189 LPIALHHLGLDPNSKKAEDYEQAKALMLKIRPYIAYFHSAKYMTDIANGDICVAIGYSGS 248 Query: 245 IYQAKSRAEEAKNKVTVKYNIPKEGAGSFFDMVAIPKDAENTEGALAFVNFLMKPEIMAE 304 YQ +RA+EA N V V + +PKEGA ++D AIP A+N + A AF++ L+ P+++A Sbjct: 249 FYQFANRAKEAGNGVVVDWRLPKEGAPLWYDSFAIPASAKNVDEAHAFLDNLLDPKVVAP 308 Query: 305 ITDVVQFPNGNAAATPLVSEAIRNDPGIYPSEEVMKKLYTFPDLPAKTQRAMTRSWTKIK 364 I+D + +PN N A PLV IR++P + P+ K LY LP K +R TR+WT IK Sbjct: 309 ISDFLGYPNPNRDAMPLVGSEIRDNPHLTPTAAAQKSLYVLQPLPLKAERLRTRAWTAIK 368 Query: 365 SG 366 SG Sbjct: 369 SG 370 Lambda K H 0.315 0.133 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 447 Number of extensions: 19 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 367 Length of database: 371 Length adjustment: 30 Effective length of query: 337 Effective length of database: 341 Effective search space: 114917 Effective search space used: 114917 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory