Align Enoyl-CoA hydratase; EC 4.2.1.17 (characterized, see rationale)
to candidate WP_090447884.1 BLS63_RS21705 enoyl-CoA hydratase
Query= uniprot:A0A2Z5MCI7 (262 letters) >NCBI__GCF_900100495.1:WP_090447884.1 Length = 272 Score = 111 bits (277), Expect = 2e-29 Identities = 80/248 (32%), Positives = 124/248 (50%), Gaps = 5/248 (2%) Query: 16 TLVLTLSNPGARNALHPDMYAAGIEALDSVERDPSIRAVVITG-ADNFFCAGGNLNRLLE 74 T ++T+++P A N D + ++ + RD I A+V+TG FF AG +LN + Sbjct: 27 TALITINHPPA-NTWDRDSLIGLKQLVEHLNRDDDIYALVVTGQGSKFFSAGADLNLFAD 85 Query: 75 NRAKDPSVQAQSIDLLAEWISALRLSSKPVIAAVDGAAAGAGFSLALACDLIVAADDAKF 134 D + + E ALR IAA++G A G G ALACDL +A A+ Sbjct: 86 G---DKARAREMARRFGEAFEALRDFRGVSIAAINGYAMGGGLECALACDLRIAERQAQL 142 Query: 135 VMSYARVGLTPDGGGSWFLAQALPRQLATEVLIEGKPIGAARLHELGVVNKLTKPGTARD 194 + A VGL P GG+ LA + A +++ G+ I A +G+V +L G AR Sbjct: 143 ALPEAAVGLLPCAGGTQHLAWLVGEGWAKRMILCGERIDAETALRIGLVEQLVDSGEARG 202 Query: 195 AAVAWADELGKISPNSVARIKTLVCAAGTQPLSEHLVAERDNFVASLHHREGLEGISAFL 254 A+ A ++ + SP +V IK L+ A + + L ER+ F+ + EG++AFL Sbjct: 203 HALLLAAKVARQSPVAVRTIKPLIQGARQRSPNSWLSEERERFIDLFDADDTREGVNAFL 262 Query: 255 EKRAPVYK 262 EKR P ++ Sbjct: 263 EKRDPQWR 270 Lambda K H 0.317 0.132 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 163 Number of extensions: 8 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 262 Length of database: 272 Length adjustment: 25 Effective length of query: 237 Effective length of database: 247 Effective search space: 58539 Effective search space used: 58539 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory