Align The fructose inducible fructose/xylitol porter, FruI (characterized)
to candidate WP_090448051.1 BLS63_RS22565 PTS fructose transporter subunit IIBC
Query= TCDB::Q1LZ59 (655 letters) >NCBI__GCF_900100495.1:WP_090448051.1 Length = 577 Score = 338 bits (867), Expect = 4e-97 Identities = 203/510 (39%), Positives = 294/510 (57%), Gaps = 45/510 (8%) Query: 148 ATEEEKKEATPAAPVADSHDFLVAVTACTTGIAHTYMAEEALKKQAAEMGVGIKVETNGA 207 A + + A PAA A LVAVTAC TG+AHT+MA EAL++ A ++G ++VET G+ Sbjct: 97 AEQAQVLAAEPAAAAATDKPRLVAVTACPTGVAHTFMAAEALQQAAEQLGYDLQVETRGS 156 Query: 208 SGVGNKLTADDIKRAKGVIIAADKAVEMDRFNGKPLISRPVAEGIKKPEELINIILDGKA 267 G N L I A V++AAD V+ RF GK + +K+P + + L A Sbjct: 157 VGARNLLDDAAIAAADAVLLAADIEVDTARFAGKKVFRCGTGVALKQPRQTLERAL---A 213 Query: 268 EAYVADNSDLSSEASSSEKAGLGSAFYKHLMSGVSQMLPFVIGGGIMIALSFLIDQFMGV 327 E + + A +S+ AG YKHL++GVS MLP V+ GG++IALSF+ Sbjct: 214 EGVPLAATGKAEAAPASQSAGQAGP-YKHLLTGVSYMLPMVVAGGLLIALSFVFGIEAFK 272 Query: 328 PKSSLSHLGNYHEIAAIFNQVGNAAFGFMIPVFAAYIAYSIAEKPGLVAGFVAGSMATTG 387 + SL+ AA+ G+AAF M+PV A YIAYSIA++PGL G + G +A++ Sbjct: 273 QEGSLA--------AALMQIGGDAAFKLMVPVLAGYIAYSIADRPGLAPGMIGGLLASS- 323 Query: 388 LAFNKVAFFEFGEKASQASLTGIPSGFLGALAGGFLAGGVILVLKKALAFVPRSLEGIKS 447 + +GF+G + GFLAG + + + +P S+E +K Sbjct: 324 ----------------------LGAGFIGGIVAGFLAGYTAKAIARWVQ-LPASVEALKP 360 Query: 448 ILLYPLLGVLVTGFLMLFV-NIPMAAINTALYNFLGNLSGGSAVLLGLIVGGMMAIDMGG 506 IL+ PLL L TG +M++V P+A + L FL + +A+LLGL++GGMM +D+GG Sbjct: 361 ILIIPLLASLFTGLVMIYVVGQPVAGMLAGLTAFLDGMGSTNAILLGLLLGGMMCVDLGG 420 Query: 507 PFNKAAYVFGTSTLTAAALAKGGSVVMASVMAGGMVPPLAVFVATLLFKNKFTQEEHDAG 566 P NKAAY F L + + A MA+VMA GMVPP+ + +A++L ++KF Q E +AG Sbjct: 421 PINKAAYAFSVGLLASQSYAP-----MAAVMAAGMVPPIGMAIASVLARHKFAQSEREAG 475 Query: 567 LTNIVMGLSFITEGAIPFGAGDPARAIPSFIVGSAVTGALVGLSGIKLMAPHGGIFVIAL 626 V+GL FI+EGAIPF A DP R IP+ I G A+TGAL G KLMAPHGG+FV+ + Sbjct: 476 KAAGVLGLCFISEGAIPFAAKDPFRVIPASIAGGALTGALSMYFGCKLMAPHGGLFVLLI 535 Query: 627 ---TSNPLLYLLYIAVGAVIAGILFGSLRK 653 ++ LYLL I G+++ G+ + +++ Sbjct: 536 PNAINHAALYLLAIVAGSLLTGVAYALIKR 565 Score = 49.3 bits (116), Expect = 5e-10 Identities = 25/91 (27%), Positives = 45/91 (49%) Query: 169 LVAVTACTTGIAHTYMAEEALKKQAAEMGVGIKVETNGASGVGNKLTADDIKRAKGVIIA 228 L+ VTAC G+ + + L+ A +G +VE + +G+ L +DI A V++ Sbjct: 3 LLIVTACPNGMVTSVLCSRLLEAAAQRLGWSTRVEVHDPRAIGSPLREEDIAAADLVLVV 62 Query: 229 ADKAVEMDRFNGKPLISRPVAEGIKKPEELI 259 + + RF GK L+ AE + P++ + Sbjct: 63 KTGELPLQRFVGKRLLQSTPAEALVDPQQFL 93 Lambda K H 0.320 0.137 0.381 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 871 Number of extensions: 43 Number of successful extensions: 7 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 655 Length of database: 577 Length adjustment: 37 Effective length of query: 618 Effective length of database: 540 Effective search space: 333720 Effective search space used: 333720 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 53 (25.0 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory