Align ABC transporter for L-Asparagine and possibly other L-amino acids, permease component 1 (characterized)
to candidate WP_090448245.1 BLS63_RS23605 amino acid ABC transporter permease
Query= reanno::pseudo13_GW456_L13:PfGW456L13_4771 (248 letters) >NCBI__GCF_900100495.1:WP_090448245.1 Length = 244 Score = 101 bits (252), Expect = 1e-26 Identities = 64/214 (29%), Positives = 106/214 (49%), Gaps = 8/214 (3%) Query: 25 YVTGLAWTIGIAIAAWIIALTLGSILGVMRTVPNRIVSGIATCYVELFRNVPLLVQLFIW 84 + G T+ +A+ A + + L + P+ + +FR P L+QL Sbjct: 17 FFRGACITLLLALLAHSVGILLSIPAALALDGPSNPARSTLRGVLSVFRGAPTLLQLLFV 76 Query: 85 YFLVPDLLPADLQEWYKQDLNPTTSAFLSVVVCLGLFTTARVCEQVRTGIQALPKGQESA 144 + +P P +EW+ + F + + L L A E R+ +QA+ KGQ +A Sbjct: 77 WNALPQFFPIFREEWF--------TPFFAAWIALSLNEAAYQVEINRSALQAVDKGQYAA 128 Query: 145 ARAMGFKLPQIYWNVLLPQAYRIIIPPLTSEFLNVFKNTSVASLIGLMELLAQTKQTAEF 204 A+G QI+ V+LPQA RI IPP ++EF+ + K TS+AS+I L EL+A T QT Sbjct: 129 GHALGLSRLQIFRYVILPQAARIAIPPTSNEFITLLKITSLASVISLQELMAVTSQTVSS 188 Query: 205 SANLFEAFTLATLIYFTLNMSLMLLMRVVEKKVA 238 + E + +A + Y + SL L +E++++ Sbjct: 189 TFQFSEYYAVALVYYLAMVYSLTWLQGGLERRLS 222 Lambda K H 0.326 0.139 0.432 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 135 Number of extensions: 7 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 248 Length of database: 244 Length adjustment: 24 Effective length of query: 224 Effective length of database: 220 Effective search space: 49280 Effective search space used: 49280 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory