Align ABC transporter for L-Arginine and L-Citrulline, permease component 1 (characterized)
to candidate WP_090448245.1 BLS63_RS23605 amino acid ABC transporter permease
Query= reanno::pseudo3_N2E3:AO353_03045 (232 letters) >NCBI__GCF_900100495.1:WP_090448245.1 Length = 244 Score = 112 bits (280), Expect = 6e-30 Identities = 75/225 (33%), Positives = 114/225 (50%), Gaps = 8/225 (3%) Query: 1 MIFDYNVIWEALPLY--FGGLVTTLKLLALSLLFGLLAALPLGLMRVSKQPIVNMSAWLY 58 M FD V W+AL Y F G TL L L+ G+L ++P L + Sbjct: 1 MNFDVAVFWDALTSYHFFRGACITLLLALLAHSVGILLSIPAALALDGPSNPARSTLRGV 60 Query: 59 TYVIRGTPMLVQLFLIYYGLAQFEAV-RESFLWPWLSSATFCACLAFAINTSAYTAEIIA 117 V RG P L+QL ++ L QF + RE + P+ F A +A ++N +AY EI Sbjct: 61 LSVFRGAPTLLQLLFVWNALPQFFPIFREEWFTPF-----FAAWIALSLNEAAYQVEINR 115 Query: 118 GSLRATPNGEIEAAKAMGMSRFKMYKRILLPSALRRALPQYSNEVIMMLQTTSLASIVTL 177 +L+A G+ A A+G+SR ++++ ++LP A R A+P SNE I +L+ TSLAS+++L Sbjct: 116 SALQAVDKGQYAAGHALGLSRLQIFRYVILPQAARIAIPPTSNEFITLLKITSLASVISL 175 Query: 178 IDITGAARTVNAQYYLPFEAYITAGVFYLCMTFILVRLFKMAEHR 222 ++ + + E Y A V+YL M + L L E R Sbjct: 176 QELMAVTSQTVSSTFQFSEYYAVALVYYLAMVYSLTWLQGGLERR 220 Lambda K H 0.329 0.139 0.427 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 112 Number of extensions: 6 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 232 Length of database: 244 Length adjustment: 23 Effective length of query: 209 Effective length of database: 221 Effective search space: 46189 Effective search space used: 46189 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory