Align High-affinity branched-chain amino acid ABC transporter permease LivM (characterized, see rationale)
to candidate WP_090448281.1 BLS63_RS23785 high-affinity branched-chain amino acid ABC transporter permease LivM
Query= uniprot:A0A159ZYE0 (418 letters) >NCBI__GCF_900100495.1:WP_090448281.1 Length = 428 Score = 411 bits (1056), Expect = e-119 Identities = 225/418 (53%), Positives = 291/418 (69%), Gaps = 9/418 (2%) Query: 3 RHLKSALFSALLVWAVAYPVLGLKLTIVGINLEVHGTSPAILATIAVCSLL-MFLRVLFS 61 + L A+ + L+ V P++G+ L NL+ + I A + +L +FL+ Sbjct: 14 KSLVDAVLAGLIALIVFGPIVGVVLDGYAFNLQPDRVAAMIGAVMLGRFVLSLFLQTPRG 73 Query: 62 TQISAMWKS-SPGLPVIPAKASNFLTLPTTQRWIVLALIVGALVWPFFGSRGAVDIATLI 120 I A +++ G+ V + L RW++ L+V ALV+PFF S+ + + L Sbjct: 74 LAILAGFETVGSGVHVRDPGYQSHL------RWVLPLLVVVALVFPFFASKYLLTVVILG 127 Query: 121 LIYVMLGLGLNIVVGLAGLLDLGYVGFYAVGAYSYALLSHYFGLSFWICLPIAGMMAATF 180 LIYV+LGLGLNIVVGLAGLLDLGYV FYA+GAY AL + GL FW LP+A + AA Sbjct: 128 LIYVLLGLGLNIVVGLAGLLDLGYVAFYAIGAYGLALGYEHLGLGFWSVLPLAALAAALA 187 Query: 181 GFLLGFPVLRLRGDYLAIVTLGFGEIIRLFLRNLTDITGGPNGISNIEKPTFFGLTFERK 240 G LLGFPVLR+ GDYLAIVTLGFGEIIRL L N TGGPNG+S + PTF GL F R+ Sbjct: 188 GGLLGFPVLRMHGDYLAIVTLGFGEIIRLVLNNWLAFTGGPNGMS-VPAPTFLGLEFSRR 246 Query: 241 AAEGLQTFHEYFGLEYNSINKVIFLYLVALLLALAALFVINRLLRMPIGRAWEALREDEI 300 A +G FHE+FG++YN+ K +F+YLV LL+ L L+V NRL RMP+GRAWEALREDEI Sbjct: 247 AKDGGVPFHEFFGIDYNANFKFLFIYLVLLLVVLLVLYVKNRLTRMPVGRAWEALREDEI 306 Query: 301 ACRALGLNPTVIKLSAFTLGAAFAGFAGSFFAARQGLVTPESFTFIESAIILAIVVLGGM 360 ACRA+GLN ++KLSAF +GA+ AG AG FFA+ QG V P SFTF ESA+ILAIVVLGGM Sbjct: 307 ACRAMGLNHVLVKLSAFMIGASTAGLAGVFFASYQGFVNPASFTFFESALILAIVVLGGM 366 Query: 361 GSQLGVILAAIVMILLPEMMREFSEYRMLMFGALMVLMMIWRPQGLLPMQRPHMELRK 418 GS +GV+LAA V+ + PE++R F+EYR+L+FG LMVLMMIWRP+GL+ + R ++ R+ Sbjct: 367 GSTVGVVLAAFVLTVAPELLRSFAEYRVLLFGVLMVLMMIWRPRGLIRVSRNGVQPRQ 424 Lambda K H 0.331 0.145 0.439 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 652 Number of extensions: 37 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 418 Length of database: 428 Length adjustment: 32 Effective length of query: 386 Effective length of database: 396 Effective search space: 152856 Effective search space used: 152856 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory