Align L-serine ammonia-lyase (EC 4.3.1.17); D-Serine ammonia-lyase (EC 4.3.1.18) (characterized)
to candidate WP_090448305.1 BLS63_RS23910 1-aminocyclopropane-1-carboxylate deaminase
Query= BRENDA::O57809 (325 letters) >NCBI__GCF_900100495.1:WP_090448305.1 Length = 337 Score = 171 bits (432), Expect = 3e-47 Identities = 109/324 (33%), Positives = 168/324 (51%), Gaps = 20/324 (6%) Query: 8 LLAKFPRVELIPWETPIQYLPNISREIGADV--YIKRDDL-TGLGIGGNKIRKLEYLLGD 64 +L KF R L+ TPI+ L +S +G ++ Y KR+D +GL GGNKIRKLEY++ D Sbjct: 1 MLEKFERYPLMFGPTPIEKLNRLSECLGGNIQLYAKREDCNSGLAFGGNKIRKLEYIVPD 60 Query: 65 ALSKGADVVITVGAVHSNHAFVTGLAAKKLGLDAILVLRGKEELK-------GNYLLDKI 117 A++ AD ++++G V SNH A KLG+ LV + GN L+ ++ Sbjct: 61 AIASHADTLVSIGGVQSNHTRQVAAVAAKLGMKCRLVQESWVPFQDAVYDRVGNILMSRV 120 Query: 118 MGIETRVYDAKDSFELMKYAEEIAEELKREGRKPYVIPPGGA----SPIGTLGYVRAVGE 173 +G E DA + + E E++K +G KPY IP G + +G +G+ V E Sbjct: 121 LGAEIEFADAGFDIGIRESWERALEDVKAKGGKPYAIPAGASVHKYGGLGYVGFAEEVRE 180 Query: 174 IATQSEVKFDSIVVAAGSGGTLAGLSLGLSILNEDIRPVGIAVGRFGEVMTSKLDNLIKE 233 Q +KFD I+V +G T AG+ +G + +GI E +++ + + Sbjct: 181 QEAQMGIKFDYIIVCTVTGSTHAGMLVGFAKDGRARHVIGIDASGTPEQTRAQVLAIAQH 240 Query: 234 AAELLGVKVEVRPE----LYDYSFGEYGKITGEVAQIIRKVGTREGIILDPVYTGKAFYG 289 AEL+G+ E+ + +Y++ YG + E IR EG++ DPVY GK+ G Sbjct: 241 TAELVGLGQEITADDVILREEYAYPAYGIPSEETNAAIRLCARMEGMMTDPVYEGKSMQG 300 Query: 290 LVDLARKGEL--GEKILFIHTGGI 311 L+DL RKG G K+L+ H GG+ Sbjct: 301 LIDLVRKGFFPDGSKVLYAHLGGV 324 Lambda K H 0.319 0.142 0.402 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 278 Number of extensions: 17 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 325 Length of database: 337 Length adjustment: 28 Effective length of query: 297 Effective length of database: 309 Effective search space: 91773 Effective search space used: 91773 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory