Align 2-deoxy-D-ribonate 3-dehydrogenase (characterized)
to candidate WP_090448356.1 BLS63_RS24180 KR domain-containing protein
Query= reanno::Burk376:H281DRAFT_00644 (263 letters) >NCBI__GCF_900100495.1:WP_090448356.1 Length = 244 Score = 92.0 bits (227), Expect = 1e-23 Identities = 77/251 (30%), Positives = 113/251 (45%), Gaps = 21/251 (8%) Query: 17 VSAGAAGIGLAIAEAFIEAQAEVYICDVNQAA-----IDEATSRFPKLHAGIADVSKQAQ 71 V+ + GIG AIA+ V + ++ A + + S + +A +AD+S Sbjct: 7 VTGASRGIGAAIAKRLAADGISVVVNYTSRPADAEQVVRDIVSAGGQAYAVLADISDSVA 66 Query: 72 VDQIIDDARRKLGGLDVLVNNAGIAGPTGAVE--ELDPAQWESTVSTNLNSQFYFLRKAV 129 V+ + D A K GG+D+LVNNAG+ P G V + D A ++ + N F LR A Sbjct: 67 VEALFDQAELKFGGIDILVNNAGVIQP-GMVNLADSDDALYQKIFAINTKGTFNTLRLAA 125 Query: 130 PVLKETSDCASIIAMSSVAGRLGYPFRTPYASTKWAIVGLVKSLAAELGPSNVRVNAILP 189 L+ D I+ S+ L P + YA++K A+ A EL N+ VNAI P Sbjct: 126 RHLR---DGGRIVNFSTSVVGLALPGYSLYAASKAAVESFTVIFAKELRGRNICVNAIAP 182 Query: 190 GVVEGERMDRVISARADALGIPFNAMREEYLKKISLRRMVTVDDIAAMALFLASPAGSNV 249 G E LG M E K+ L R+ T +DIA + FL G V Sbjct: 183 GPTATELF----------LGGKTAEMIERLTKQPPLERLGTPEDIANVVAFLVGEQGGWV 232 Query: 250 TGQAISVDGNV 260 GQ + V+G + Sbjct: 233 NGQVLRVNGGI 243 Lambda K H 0.318 0.134 0.375 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 130 Number of extensions: 5 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 263 Length of database: 244 Length adjustment: 24 Effective length of query: 239 Effective length of database: 220 Effective search space: 52580 Effective search space used: 52580 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory