Align C4-dicarboxylate-binding periplasmic protein DctP (characterized)
to candidate WP_090448357.1 BLS63_RS24185 C4-dicarboxylate ABC transporter
Query= SwissProt::Q9HU18 (331 letters) >NCBI__GCF_900100495.1:WP_090448357.1 Length = 335 Score = 397 bits (1019), Expect = e-115 Identities = 192/331 (58%), Positives = 253/331 (76%), Gaps = 2/331 (0%) Query: 1 MLKHTAKALVCALSLTVAGI--VQAADPIVIKFSHVVAEHTPKGQGALLFKKLVEERLPG 58 M K CAL+L A Q PI+IKFSHVVA++TPKGQGALLFK+LVE+RL G Sbjct: 1 MFKSIIAMASCALALASASADGAQQPSPILIKFSHVVADNTPKGQGALLFKQLVEQRLAG 60 Query: 59 KVKVEVYPNSSLFGDGKEMEALLLGDVQIIAPSLAKFEQYTKKLQIFDLPFLFDNIQAVD 118 KV+VEVYPNS+L+GD E+EAL +VQ++APSLAKFE+YT++LQ+FDLPFLFD++ AV+ Sbjct: 61 KVRVEVYPNSTLYGDANELEALRNDEVQLLAPSLAKFEKYTQQLQVFDLPFLFDDLDAVN 120 Query: 119 RFQQSPQGKELLTSMQDKGITGLGYWHNGMKQLSANKPLREPKDARGLKFRVQASKVLEE 178 RFQ+ +G++LL SM+ I GL YWHNGMKQLSA+K L P DA GL FR+Q S VLE Sbjct: 121 RFQKRAKGRQLLRSMEQHNIVGLAYWHNGMKQLSASKALLLPGDAAGLSFRIQPSGVLEA 180 Query: 179 QFKAVRANPRKMSFAEVYQGLQTGVVNGTENPWSNIYSQKMHEVQKYITESDHGVLDYMV 238 QF+ + A P+K++F+EV++ LQ+G V G ENPWSNIYSQK+H VQ YITE++HGVLDYM+ Sbjct: 181 QFQQLGATPQKLAFSEVFKALQSGQVQGAENPWSNIYSQKLHSVQPYITETNHGVLDYML 240 Query: 239 ITNTKFWNGLPEDVRGVLAKTMDEVTVEVNKQAEALNQGDKQRIVEAKTSEIIELTPEQR 298 ++N +FW G+P +R L +DEVT VN+QAEA NQ D+QRI + +S++I L +QR Sbjct: 241 VSNPRFWYGIPHGIRMELEGIVDEVTYAVNRQAEAANQADRQRIEASGSSQLISLDAQQR 300 Query: 299 AEWRKAMQPVWKKFEGEIGADLIKAAEAANQ 329 WR+AM+PVW++FE IG D++ AA+ N+ Sbjct: 301 EAWRQAMRPVWQRFEAAIGRDVMNAAQTVNR 331 Lambda K H 0.316 0.132 0.376 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 334 Number of extensions: 8 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 331 Length of database: 335 Length adjustment: 28 Effective length of query: 303 Effective length of database: 307 Effective search space: 93021 Effective search space used: 93021 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory