Align 2-(1,2-epoxy-1,2-dihydrophenyl)acetyl-CoA isomerase (EC 5.3.3.18) (characterized)
to candidate WP_090448449.1 BLS63_RS24680 enoyl-CoA hydratase
Query= BRENDA::P77467 (262 letters) >NCBI__GCF_900100495.1:WP_090448449.1 Length = 267 Score = 107 bits (266), Expect = 3e-28 Identities = 77/241 (31%), Positives = 115/241 (47%), Gaps = 12/241 (4%) Query: 3 EFILSHVEKGVMTLTLNRPERLNSFNDEMHAQLAECLKQVERDDTIRCLLLTGAGRGFCA 62 +F+ V + LNRP++ N+ N +M +L C KQ+ + +R ++LTG G FCA Sbjct: 4 KFVELSYSGSVAIVRLNRPDKHNALNTQMLLELIACGKQLRSNRDVRAVILTGNGPSFCA 63 Query: 63 GQDLNDRNVDPTGPAPDLGMSVERFYNPLVRRLAK-------LPKPVICAVNGVAAGAGA 115 G DL D TG M+ + P + R + L PVI A++G GAG Sbjct: 64 GMDLRDIM---TGGLLKKLMAFLPLWKPTMNRYQRVSLVWRSLSVPVIAAIHGNCFGAGL 120 Query: 116 TLALGGDIVIAARSAKFVMAFSKLGLIPDCGGTWLLPRVAGRARAMGLALLGNQLSAEQA 175 +ALG DI IAA ++ + S GL+PD GGT +L + + AM L G + AEQA Sbjct: 121 QVALGADIRIAAPGSQLSIMESNWGLVPDMGGTVVLRELLPKDVAMELTFSGRTIGAEQA 180 Query: 176 HEWGMIWQVVDDETLADTAQQLARHLATQPTFGLGLIKQAINSAETNTLDTQLDLERDYQ 235 ++ + DD A +L Q L K+ + A + + + L ER +Q Sbjct: 181 KALWLVTHIADDP--LKVAYELCHEFEGQSPDALAAGKKLLIGAWSGSESSALRQERLWQ 238 Query: 236 R 236 R Sbjct: 239 R 239 Lambda K H 0.321 0.136 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 160 Number of extensions: 5 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 262 Length of database: 267 Length adjustment: 25 Effective length of query: 237 Effective length of database: 242 Effective search space: 57354 Effective search space used: 57354 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory