Align Dihydrolipoyl dehydrogenase; EC 1.8.1.4; Dihydrolipoamide dehydrogenase; E3 component of 2-oxoglutarate dehydrogenase complex (uncharacterized)
to candidate WP_090448523.1 BLS63_RS25065 pyridine nucleotide-disulfide oxidoreductase
Query= curated2:O84561 (465 letters) >NCBI__GCF_900100495.1:WP_090448523.1 Length = 713 Score = 246 bits (628), Expect = 2e-69 Identities = 147/448 (32%), Positives = 238/448 (53%), Gaps = 17/448 (3%) Query: 8 VVIGAGPGGYVAAITAAQAGLKTALIEKREAGGTCLNRGCIPSKALLAGAEVVTQIRHAD 67 +VIGAG GG V+A AA + L+EK + GG CLN GC+PSKALL A + +++ + Sbjct: 241 LVIGAGAGGLVSAYIAAAVKARVGLVEKHKMGGDCLNTGCVPSKALLRSARLAHELQKGE 300 Query: 68 QFGIHVEGFSINYPAMVQRKDSVVRSIRDGLNGLIRSNK--ITVFSGRGSLISSTEVKIL 125 G ++++PA++QR V+ +I + + R + + V G + S V++ Sbjct: 301 ALGFTGVSGAVDFPAVMQRIQRVIGAIEPH-DSVARYTELGVEVIQGEARITSPWTVEVN 359 Query: 126 GENPSVIKAHSIILATGSEPRAFPGIPFSAESPRILCSTGVLNLKEIPQKMAIIGGGVIG 185 G + + + S+I+A G+ P P IP + P S + +L+E P+ + ++GGG IG Sbjct: 360 GRS---LSSRSLIIAAGARPLV-PPIPGLEQVPAYT-SDSIWSLRERPRWLLVLGGGPIG 414 Query: 186 CEFASLFHTLGSEVSVIEASSQILALNNPDISKTMFDKFTRQGLRFVLEASVSNIEDIGD 245 CE A F LGS+V +E + ++L + D S + G+ L+ E + Sbjct: 415 CELAQAFQRLGSQVIQVELAERLLPREDADASAALLASLQADGVDVRLQHRAERFEVVDG 474 Query: 246 RVRLTIN------GNVEEYDYVLVSIGRRLNTENIGLDKAGVICDERGVIPTDATMRTNV 299 R+ +D +L+++GR N G+++ G+ G + TD + T Sbjct: 475 EPRMVARRLDSGEAVTIAFDCLLLALGRVANVTGYGVEELGLALRPNGTLETDPYLATRF 534 Query: 300 PNIYAIGDITGKWQLAHVASHQGIIAARNI---AGHKEEIDYSAVPSVIFTFPEVASVGL 356 PNIYA+GD+TG +Q HVA+HQ AA N + ++DY +P FT PEVA VGL Sbjct: 535 PNIYAVGDVTGPYQFTHVAAHQAWYAAVNALFRGFRRFKVDYRVIPYCTFTAPEVARVGL 594 Query: 357 SPTAAQQQKIPVKVTKFPFRAIGKAVAMGEADGFAAIISHETTQQILGAYVIGPHASSLI 416 S AQ Q + +VT+F + +A+A A G+ +++ +ILG ++G A L+ Sbjct: 595 SEGEAQAQGVAYEVTRFGLDELDRAIADEAAQGYVKVLTVPGKDRILGVCIVGEQAGELL 654 Query: 417 SEITLAVRNELTLPCIYETIHAHPTLAE 444 +E LA++++L L I TIH++PTLAE Sbjct: 655 AEYVLAMKHDLGLNQILGTIHSYPTLAE 682 Lambda K H 0.319 0.135 0.388 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 713 Number of extensions: 36 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 465 Length of database: 713 Length adjustment: 36 Effective length of query: 429 Effective length of database: 677 Effective search space: 290433 Effective search space used: 290433 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 53 (25.0 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory