Align lysine/arginine/ornithine ABC transporter, periplasmic lysine/arginine/ornithine-binding protein ArgT (characterized)
to candidate WP_090448708.1 BLS63_RS26095 ABC transporter substrate-binding protein
Query= CharProtDB::CH_003045 (260 letters) >NCBI__GCF_900100495.1:WP_090448708.1 Length = 259 Score = 230 bits (586), Expect = 3e-65 Identities = 115/255 (45%), Positives = 164/255 (64%), Gaps = 5/255 (1%) Query: 6 LALSLLIGLGATAASYAALPQTVRIGTDTTYAPFSSKDAKGEFIGFDIDLGNEMCKRMQV 65 LALS+L L A + A P +RIG + Y PF+ K +G GFD D+GN +C+ MQV Sbjct: 10 LALSMLSPL---AVAEEAKP--LRIGIEAAYPPFAYKTPEGNITGFDYDIGNALCEEMQV 64 Query: 66 KCTWVASDFDALIPSLKAKKIDAIISSLSITDKRQQEIAFSDKLYAADSRLIAAKGSPIQ 125 KC W+ +FD LIP+LK +K DA++SS++IT++R + + FS K Y + +RL G+ + Sbjct: 65 KCQWIEQEFDGLIPALKVRKFDAVLSSMNITEERLKSVDFSKKYYNSPARLAMKAGTALN 124 Query: 126 PTLESLKGKHVGVLQGSTQEAYANDNWRTKGVDVVAYANQDLIYSDLTAGRLDAALQDEV 185 L LKGK VGV + S + YA+D + G++VV Y++Q+ I+ DL AGRLDA L D V Sbjct: 125 DPLVDLKGKKVGVQRASIYDRYASDVFAPAGIEVVRYSSQNEIFLDLAAGRLDATLADAV 184 Query: 186 AASEGFLKQPAGKEYAFAGPSVKDKKYFGDGTGVGLRKDDTELKAAFDKALTELRQDGTY 245 +GFLK AGK YA GP+ + +YFG+G G+ +RK DT L F A+ +R +G Y Sbjct: 185 NIDDGFLKTDAGKGYALVGPTFSEAEYFGEGAGIAVRKGDTALADKFTAAIAAIRANGKY 244 Query: 246 DKMAKKYFDFNVYGD 260 ++ KYFDF++YGD Sbjct: 245 KEVQDKYFDFDIYGD 259 Lambda K H 0.315 0.132 0.374 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 215 Number of extensions: 10 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 260 Length of database: 259 Length adjustment: 24 Effective length of query: 236 Effective length of database: 235 Effective search space: 55460 Effective search space used: 55460 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory