Align PP1069, component of Acidic amino acid uptake porter, AatJMQP (characterized)
to candidate WP_090448710.1 BLS63_RS26105 amino acid ABC transporter permease
Query= TCDB::Q88NY4 (223 letters) >NCBI__GCF_900100495.1:WP_090448710.1 Length = 232 Score = 95.9 bits (237), Expect = 6e-25 Identities = 69/226 (30%), Positives = 113/226 (50%), Gaps = 10/226 (4%) Query: 1 MEMDFSEIIPALPALWEGMVMTLKLMVMGVIGGIVLGTILALMRLSSSKLLSNLAGAYVN 60 M D++ I LP G+++TLKL+++ + G+ + L LMR+S S+LL+ A Y Sbjct: 1 MIFDYNVIWENLPLYLGGVLVTLKLLLIALALGLAMAIPLGLMRVSKSQLLNFPAWLYTY 60 Query: 61 YFRSIPLLLVITWFYL------AVPFVLRWITGEDTPVGAFTSCVVAFMMFEAAYFCEIV 114 R P+L+ + Y AV L W D A ++AF + +AY EI+ Sbjct: 61 VIRGTPMLVQLFLIYYGLAQFEAVREGLLWPYLSDATFCA----ILAFAINTSAYSAEIL 116 Query: 115 RAGVQSISKGQMGAAQALGMNYAQTMRLIILPQAFRKMTPLLLQQSIILFQDTSLVYTVG 174 +++ G++ AA+A+GM+ A+ R I+LP A R+ P + I++ TSL V Sbjct: 117 AGSLRATPHGEIEAAKAMGMSRAKLYRRILLPSALRRALPQYSNEVIMMLHTTSLASIVT 176 Query: 175 LVDFLNSARSNGDIIGRSHEFLIFAGVVYFLISFSASWLVKRLQKR 220 L+D +AR+ E I AG Y +++F L K ++R Sbjct: 177 LIDITGAARTVSSQHYLPFEAFITAGAFYLVLTFILVRLFKSAERR 222 Lambda K H 0.330 0.141 0.417 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 132 Number of extensions: 6 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 223 Length of database: 232 Length adjustment: 22 Effective length of query: 201 Effective length of database: 210 Effective search space: 42210 Effective search space used: 42210 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory