Align Histidine transport system permease protein HisQ (characterized)
to candidate WP_090448710.1 BLS63_RS26105 amino acid ABC transporter permease
Query= SwissProt::P52094 (228 letters) >NCBI__GCF_900100495.1:WP_090448710.1 Length = 232 Score = 104 bits (260), Expect = 1e-27 Identities = 70/212 (33%), Positives = 107/212 (50%), Gaps = 2/212 (0%) Query: 10 LQGALVTLELAISSVVLAVIIGLIGAGGKLSQNRLSGLIFEGYTTLIRGVPDLVLMLLIF 69 L G LVTL+L + ++ L + + + ++S+++L YT +IRG P LV + LI+ Sbjct: 16 LGGVLVTLKLLLIALALGLAMAIPLGLMRVSKSQLLNFPAWLYTYVIRGTPMLVQLFLIY 75 Query: 70 YGLQIALNTVTEAMGVGQIDIDPMVAGIITLGFIYGAYFTETFRGAFMAVPKGHIEAATA 129 YGL V E + + D I+ AY E G+ A P G IEAA A Sbjct: 76 YGLA-QFEAVREGLLWPYLS-DATFCAILAFAINTSAYSAEILAGSLRATPHGEIEAAKA 133 Query: 130 FGFTRGQVFRRIMFPSMMRYALPGIGNNWQVILKSTALVSLLGLEDVVKATQLAGKSTWE 189 G +R +++RRI+ PS +R ALP N ++L +T+L S++ L D+ A + + Sbjct: 134 MGMSRAKLYRRILLPSALRRALPQYSNEVIMMLHTTSLASIVTLIDITGAARTVSSQHYL 193 Query: 190 PFYFAIVCGVIYLVFTTVSNGVLLFLERRYSV 221 PF I G YLV T + + ERR+ V Sbjct: 194 PFEAFITAGAFYLVLTFILVRLFKSAERRWLV 225 Lambda K H 0.328 0.145 0.422 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 121 Number of extensions: 5 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 228 Length of database: 232 Length adjustment: 23 Effective length of query: 205 Effective length of database: 209 Effective search space: 42845 Effective search space used: 42845 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory