Align Succinylornithine transaminase (EC 2.6.1.81) (characterized)
to candidate WP_090448727.1 BLS63_RS26240 4-aminobutyrate--2-oxoglutarate transaminase
Query= reanno::pseudo1_N1B4:Pf1N1B4_3440 (406 letters) >NCBI__GCF_900100495.1:WP_090448727.1 Length = 297 Score = 144 bits (362), Expect = 4e-39 Identities = 92/284 (32%), Positives = 140/284 (49%), Gaps = 24/284 (8%) Query: 134 IVAALNSFHGRTLFTVNVGGQS-KYSDGFGPKITGITHVPY----------NDLAALKAA 182 ++A +HGRT+ T+++ G+ Y+ G G G+ Y +A+++ Sbjct: 3 VIAFTGGYHGRTMMTLSLTGKKVPYAAGMGLMPAGVYRAQYPCALHGVSVDEAMASIERV 62 Query: 183 VSDKT-----CAVVLEPIQGEGGVLPAELSYLQGARELCDAHNALLVFDEVQTGMGRSGK 237 + A+V+EP+QGEGG A ++ R LCD H LL+ DEVQTG GR+G Sbjct: 63 FKNDAEPRDIAAIVIEPVQGEGGFYVAPKDFMARLRALCDQHGILLIADEVQTGAGRTGT 122 Query: 238 LFAYQHYGVTPDILTSAKSLGGGFPIAAMLTTEDLAKHLVVGTHGTTYGGNPLACAVAEA 297 FA + GV D+ T AKS+ GGFP+A + + + G G TY G+P+ACA A A Sbjct: 123 FFAMEQMGVAADLTTFAKSIAGGFPLAGVCGKAEYMDAIAPGGLGGTYAGSPIACAAALA 182 Query: 298 VIDVINTPEVLNGVNAKHDKFKTRLEQIGEKYGLFTEVRGLGLLLGCVL---SDAWKGKA 354 V+ V ++L A ++ L+ I K+ +VR LG ++ L D K A Sbjct: 183 VMQVFEEEQLLARSRAVGERLVAGLKAIQSKHKAIGDVRALGAMIALELFEGGDVHKPNA 242 Query: 355 ---KDIFNAAEREGLMILQAGP--DVIRFAPSLVVEDADIDAGL 393 + A +GL++L G +V+R L DA +D GL Sbjct: 243 ALTAQVVAKARDKGLILLSCGSYGNVLRVLVPLTAPDAQLDQGL 286 Lambda K H 0.320 0.136 0.400 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 300 Number of extensions: 12 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 406 Length of database: 297 Length adjustment: 29 Effective length of query: 377 Effective length of database: 268 Effective search space: 101036 Effective search space used: 101036 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory