GapMind for catabolism of small carbon sources

 

Protein WP_092053541.1 in Desulfuromonas acetexigens

Annotation: NCBI__GCF_900111775.1:WP_092053541.1

Length: 221 amino acids

Source: GCF_900111775.1 in NCBI

Candidate for 29 steps in catabolism of small carbon sources

Pathway Step Score Similar to Id. Cov. Bits Other hit Other id. Other bits
L-histidine catabolism PA5503 lo Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN (characterized) 38% 67% 159.1 Cell division ATP-binding protein FtsE 49% 226.9
L-asparagine catabolism aatP lo ABC transporter for L-aspartate, L-asparagine, L-glutamate, and L-glutamine, ATPase component (characterized) 38% 89% 156.8 Cell division ATP-binding protein FtsE 49% 226.9
L-aspartate catabolism aatP lo ABC transporter for L-aspartate, L-asparagine, L-glutamate, and L-glutamine, ATPase component (characterized) 38% 89% 156.8 Cell division ATP-binding protein FtsE 49% 226.9
L-glutamate catabolism gltL lo ABC transporter for L-aspartate, L-asparagine, L-glutamate, and L-glutamine, ATPase component (characterized) 38% 89% 156.8 Cell division ATP-binding protein FtsE 49% 226.9
L-asparagine catabolism glnQ lo Glutamine ABC transporter ATP-binding protein, component of Glutamine transporter, GlnQP. Takes up glutamine, asparagine and glutamate which compete for each other for binding both substrate and the transmembrane protein constituent of the system (Fulyani et al. 2015). Tandem substrate binding domains (SBDs) differ in substrate specificity and affinity, allowing cells to efficiently accumulate different amino acids via a single ABC transporter. Analysis revealed the roles of individual residues in determining the substrate affinity (characterized) 38% 88% 150.2 Cell division ATP-binding protein FtsE 49% 226.9
D-cellobiose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 39% 61% 147.9 Cell division ATP-binding protein FtsE 49% 226.9
D-galactose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 39% 61% 147.9 Cell division ATP-binding protein FtsE 49% 226.9
D-glucose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 39% 61% 147.9 Cell division ATP-binding protein FtsE 49% 226.9
lactose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 39% 61% 147.9 Cell division ATP-binding protein FtsE 49% 226.9
D-maltose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 39% 61% 147.9 Cell division ATP-binding protein FtsE 49% 226.9
D-mannose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 39% 61% 147.9 Cell division ATP-binding protein FtsE 49% 226.9
sucrose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 39% 61% 147.9 Cell division ATP-binding protein FtsE 49% 226.9
trehalose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 39% 61% 147.9 Cell division ATP-binding protein FtsE 49% 226.9
L-asparagine catabolism aapP lo AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 34% 86% 144.4 Cell division ATP-binding protein FtsE 49% 226.9
L-aspartate catabolism aapP lo AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 34% 86% 144.4 Cell division ATP-binding protein FtsE 49% 226.9
L-glutamate catabolism aapP lo AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 34% 86% 144.4 Cell division ATP-binding protein FtsE 49% 226.9
L-histidine catabolism aapP lo AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 34% 86% 144.4 Cell division ATP-binding protein FtsE 49% 226.9
L-leucine catabolism aapP lo AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 34% 86% 144.4 Cell division ATP-binding protein FtsE 49% 226.9
L-proline catabolism aapP lo AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 34% 86% 144.4 Cell division ATP-binding protein FtsE 49% 226.9
L-asparagine catabolism bgtA lo ATPase (characterized, see rationale) 36% 84% 141.7 Cell division ATP-binding protein FtsE 49% 226.9
L-aspartate catabolism bgtA lo ATPase (characterized, see rationale) 36% 84% 141.7 Cell division ATP-binding protein FtsE 49% 226.9
L-histidine catabolism BPHYT_RS24015 lo ABC transporter related (characterized, see rationale) 37% 85% 137.1 Cell division ATP-binding protein FtsE 49% 226.9
L-alanine catabolism braG lo NatE aka LivF aka SLR1881, component of Leucine/proline/alanine/serine/glycine (and possibly histidine) porter, NatABCDE (characterized) 32% 85% 109.8 Cell division ATP-binding protein FtsE 49% 226.9
L-histidine catabolism natE lo NatE aka LivF aka SLR1881, component of Leucine/proline/alanine/serine/glycine (and possibly histidine) porter, NatABCDE (characterized) 32% 85% 109.8 Cell division ATP-binding protein FtsE 49% 226.9
L-leucine catabolism natE lo NatE aka LivF aka SLR1881, component of Leucine/proline/alanine/serine/glycine (and possibly histidine) porter, NatABCDE (characterized) 32% 85% 109.8 Cell division ATP-binding protein FtsE 49% 226.9
L-proline catabolism natE lo NatE aka LivF aka SLR1881, component of Leucine/proline/alanine/serine/glycine (and possibly histidine) porter, NatABCDE (characterized) 32% 85% 109.8 Cell division ATP-binding protein FtsE 49% 226.9
L-serine catabolism braG lo NatE aka LivF aka SLR1881, component of Leucine/proline/alanine/serine/glycine (and possibly histidine) porter, NatABCDE (characterized) 32% 85% 109.8 Cell division ATP-binding protein FtsE 49% 226.9
L-threonine catabolism braG lo NatE aka LivF aka SLR1881, component of Leucine/proline/alanine/serine/glycine (and possibly histidine) porter, NatABCDE (characterized) 32% 85% 109.8 Cell division ATP-binding protein FtsE 49% 226.9
L-arabinose catabolism xylGsa lo Xylose/arabinose import ATP-binding protein XylG; EC 7.5.2.13 (characterized, see rationale) 30% 86% 98.6 Cell division ATP-binding protein FtsE 49% 226.9

Sequence Analysis Tools

View WP_092053541.1 at NCBI

Find papers: PaperBLAST

Find functional residues: SitesBLAST

Search for conserved domains

Find the best match in UniProt

Compare to protein structures

Predict transmenbrane helices: Phobius

Predict protein localization: PSORTb

Find homologs in fast.genomics

Fitness BLAST: loading...

Sequence

MIQFYNVCKSYKKDAAALVDLNLKIPKGDFVYITGPSGAGKSTLLKLLYAAEKPTRGQIL
INSQNVTRMGSRQIPFLRRRLGIVFQDFKLLNTRTVFENVAFPLEVQGRKRMEVGKKVFQ
TLKLVGLEHKLNRLPLELSGGEQQRVAVARALVIDPLVLIADEPTGNLDPEVTLDIMELF
KGANARGSTVLLATHDREMIRRFPRRVLTLEHGRLIEDRPA

This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory