Align 2-aminoadipate transaminase (EC 2.6.1.39) (characterized)
to candidate WP_092344171.1 BLU87_RS01565 aspartate aminotransferase family protein
Query= reanno::Putida:PP_4108 (416 letters) >NCBI__GCF_900107645.1:WP_092344171.1 Length = 460 Score = 188 bits (478), Expect = 3e-52 Identities = 138/425 (32%), Positives = 216/425 (50%), Gaps = 17/425 (4%) Query: 2 NQESISQSIAIVHPITLSHGRNAEVWDTDGKRYIDFVGGIGVLNLGHCNPAVVEAIQAQA 61 + ES + S A P+ ++ G+ A + D DG YID G GV+ LGH +P V++A Sbjct: 36 DNESSAISYAKGMPMAMAKGKGATIEDVDGNIYIDMFSGAGVMALGHSHPDVLKASHEAI 95 Query: 62 TRLTHYAFNAAPHGPYLALMEQLSQFVPVSYPLAGMLTNSGAEAAENALKVARGATGKRA 121 +TH +P +++ + + +P +G++A E A+K+A+ TG+ Sbjct: 96 EDITHTLDIPSPIRQ--RMVKSMKKILPKELTRVFFGGPTGSDAVEQAIKLAKFNTGRYG 153 Query: 122 IIAFDGGFHGRTLATLNLNGKVAPYKQRVGELPGPVYHLPYPSA---DTGVTCE----QA 174 +IAF+G +HG T L L A ++Q +G L V LPYP G E QA Sbjct: 154 VIAFEGSYHGMTGMALALTCD-AHHRQGLGPLSPGVQFLPYPYEYRNPFGCPDEDLQLQA 212 Query: 175 LKAMDRLFS-VELAVEDVAAFIFEPVQGEGGFLALDPAFAQALRRFCDERGILIIIDEIQ 233 + ++R+ S AA I E VQGEGG + P F Q +R C + I++I DEIQ Sbjct: 213 AENLERVLSDSHSGYLKPAAVILESVQGEGGTIIPAPIFLQRVREICTKHDIVMICDEIQ 272 Query: 234 SGFGRTGQRFAFPRLGIEPDLLLLAKSIAG-GMPLGAVVGRKELMAALPKGGLGGTYSGN 292 +G GRTG+ FAF GI PD++ ++K++ G G P+ A+ R+EL P G GT+ GN Sbjct: 273 AGLGRTGKMFAFEHAGIVPDIVTMSKALGGIGFPISAIAYREEL-NTWPTGLTIGTFRGN 331 Query: 293 PISCAAALASLAQMTDENLATWGERQEQAIVSRYERWKASGLSPYIGRLTGVGAMRGIEF 352 I+ AA A+L M D + + + + + +A S +G G+G M IE Sbjct: 332 MIAFAAGSAALEWMQDNGVIEHAAGLGEKCMVKLKELEAQ--SAIVGESRGLGMMLAIEM 389 Query: 353 ANADGSPAPA-QLAK-VMEAARARGLLLMPSGKARHIIRLLAPLTIEAEVLEEGLDILEQ 410 S PA AK V + A RG+++ G ++ RLL PL I ++ +G++I+ Sbjct: 390 VKDKESREPAGDYAKLVRKHAHLRGVMIEVGGHHGNVARLLPPLIITEDLAMKGIEIIAG 449 Query: 411 CLAEL 415 + ++ Sbjct: 450 VIKDI 454 Lambda K H 0.320 0.137 0.402 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 504 Number of extensions: 20 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 416 Length of database: 460 Length adjustment: 32 Effective length of query: 384 Effective length of database: 428 Effective search space: 164352 Effective search space used: 164352 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory