Align aminobutyraldehyde dehydrogenase (EC 1.2.1.19) (characterized)
to candidate WP_092344789.1 BLU87_RS03510 NAD-dependent succinate-semialdehyde dehydrogenase
Query= BRENDA::Q8VWZ1 (503 letters) >NCBI__GCF_900107645.1:WP_092344789.1 Length = 452 Score = 238 bits (607), Expect = 3e-67 Identities = 139/461 (30%), Positives = 233/461 (50%), Gaps = 14/461 (3%) Query: 25 IPNINPSTENIIGDIPAATKEDVDLAVDAAKRAISRKNGRDWSAASGSLRARYLRAIAAK 84 + ++NP+T ++ + E V ++A A ++W S + R L A Sbjct: 3 LESLNPATGEVLETFDEWSDEQVATTIEAVHGAY-----QNWRTTSFAERKSLLLKAAVI 57 Query: 85 IKEKKDELGKLESIDCGKPLEEALADLDDVVACFEYYAGLAEELDSKQKAPISLPMDTFK 144 ++++KDE + +++ GKP+ E A+++ YYA AE++ AP + D + Sbjct: 58 LRQRKDEFATMMALEMGKPVVEGRAEIEKCALVCNYYAENAEQM----LAPEPIASDASR 113 Query: 145 SYILKEPIGVVALITPWNYPFLMATWKIAPALAAGCAAILKPSELASVTCLELGEICKEV 204 SY+ P G+V + PWN+PF APAL AG +LK + L + ++ E Sbjct: 114 SYVAFRPQGIVLAVMPWNFPFWQVFRFAAPALMAGNVGVLKHASNVPRCALAIEQVFVEA 173 Query: 205 GLPRGVLNIVTGLGHEAGASLASHPDVDKISFTGSSATGSKIMTTAAQLVKPVSLELGGK 264 G P V + +G A + HP V + TGS G K+ + ++K +ELGG Sbjct: 174 GYPADVFRTLM-IGSGKVAQVIEHPYVVATTLTGSDIAGRKVAEKSGAMLKKSVMELGGS 232 Query: 265 SPIVVFEDVDLDKVAEWTVFGCFFTNGQICSATSRLIVHESIAVEFVDKLVKWAENIKIS 324 P +V D DLD A V +GQ C A R IV + I F++K +K+ Sbjct: 233 DPFIVLNDADLDLAASVAVTARCINSGQSCIAAKRFIVEDGIYETFLEKFKANMAALKMG 292 Query: 325 DPLEEGCRLGPIVSEAQYKKVLNCISSAKSEGATILTGGRRPEHLKKGYFVEPTIITDVT 384 DP +E ++GP E +++ + + ++GA ++ GG E F PTI+T V+ Sbjct: 293 DPCDETTQVGPQAREDLMRELHRQVEGSVAKGAKVILGGMPGE----AAFYPPTILTQVS 348 Query: 385 TSMQIWREEVFGPVLAVKTFSTEEEAINLANDTHYGLGSAVMSNDLERCERLSKALQAGI 444 M + EE FGPV V EEA+ +ANDT +GLG +V + D+ + E+++ +++G Sbjct: 349 KGMPAYNEEFFGPVAIVIRVKDAEEALFVANDTEFGLGGSVWTRDIIKGEKIAGEIRSGA 408 Query: 445 VWINCAQPSFIQAPWGGIKRSGFGRELGEWGLENYLSVKQV 485 V++N S + P+GG+ SGFGREL +G++ +++++ V Sbjct: 409 VFVNSMTKSDPRLPFGGVGISGFGRELSHYGIKEFVNIQTV 449 Lambda K H 0.317 0.134 0.402 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 462 Number of extensions: 13 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 503 Length of database: 452 Length adjustment: 33 Effective length of query: 470 Effective length of database: 419 Effective search space: 196930 Effective search space used: 196930 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory