Align ABC transporter for L-Glutamine, L-Histidine, and other L-amino acids, permease component 2 (characterized)
to candidate WP_092344930.1 BLU87_RS03910 amino acid ABC transporter permease
Query= reanno::Smeli:SMc02120 (384 letters) >NCBI__GCF_900107645.1:WP_092344930.1 Length = 363 Score = 311 bits (797), Expect = 2e-89 Identities = 168/361 (46%), Positives = 231/361 (63%), Gaps = 17/361 (4%) Query: 20 PSLESGAVSWLRKNLFATPKDTALTIISLLILAWLVPPAIQWLFIDAAWSGGGRGVCATL 79 P G + WL NLF + ++ LTI++L+++A+L+PPA QW F+D+ W+ C + Sbjct: 15 PITNVGVLGWLHTNLFNSWYNSLLTIVTLIVMAFLLPPAFQWAFVDSLWNSSAEA-CRDI 73 Query: 80 SQGGSQPEGWSGACWAFVNAKFAQFLFGRYPLDERWRPALVGILFVLLLVPMLIPRIPYK 139 GACW+ + + G +P + WRP L VLLL ++ + + Sbjct: 74 D----------GACWSVIPNNIRFIILGFFPSGQEWRPILA---MVLLLTLVVYSKERSR 120 Query: 140 GLNALLLLVALP-ILSAILLPGGWFGLTYVETPLWGGLMVTLVLSFVGIAVSLPLGILLA 198 ++LL L A+ I+ L+ GG FG+ VET W GL +T +LSF G+ V+ PLGILLA Sbjct: 121 WKSSLLWLWAINLIIMGTLMYGGIFGMPVVETSQWSGLPLTFILSFFGMIVAYPLGILLA 180 Query: 199 LGRRSNMPVIKMLCTVFIEVIRGVPLITVLFMASVMLPLFLPQGVTFDKFLRALIGVSLF 258 LGR+SNMP IK LC V+IE+IRGVPLI++LFM+SVM PLFLP+GVT DK LRALI + LF Sbjct: 181 LGRQSNMPAIKTLCVVYIELIRGVPLISLLFMSSVMFPLFLPEGVTIDKVLRALIAIILF 240 Query: 259 ASAYMAEVVRGGLQAIPKGQYEGADSLGLSFWQKMGFIVLPQALKLVIPGIVNTFIGLFK 318 +AY+AEVVRGGLQA+P+GQYE ADSLGL++ M I+LPQALK+VIP V + +FK Sbjct: 241 TAAYIAEVVRGGLQAMPRGQYEAADSLGLNYSNTMRLIILPQALKIVIPPSVGILLSVFK 300 Query: 319 DTSLVSIIGMFDLLGIVRLNFSDTNWATAVTPLTGLIFAGFVFWLFCFGMSRYSGFMERL 378 DTSLV II ++D+L + S+ WA IF +++ FC+ MS YS +E+ Sbjct: 301 DTSLVVIIALYDVLKTTMVTLSNPKWAG--YSRESYIFLALLYFGFCYAMSSYSRKLEKE 358 Query: 379 L 379 L Sbjct: 359 L 359 Lambda K H 0.329 0.144 0.454 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 487 Number of extensions: 19 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 384 Length of database: 363 Length adjustment: 30 Effective length of query: 354 Effective length of database: 333 Effective search space: 117882 Effective search space used: 117882 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory