Align ABC transporter ATP-binding protein-branched chain amino acid transport, component of The branched chain hydrophobic amino acid transporter, LivJFGHM (characterized)
to candidate WP_092344946.1 BLU87_RS03955 ABC transporter ATP-binding protein
Query= TCDB::Q8DQH8 (254 letters) >NCBI__GCF_900107645.1:WP_092344946.1 Length = 265 Score = 238 bits (608), Expect = 7e-68 Identities = 119/251 (47%), Positives = 174/251 (69%) Query: 3 LLEVKQLTKHFGGLTAVGDVTLELNEGELVGLIGPNGAGKTTLFNLLTGVYEPSEGTVTL 62 +LEV+ LT+ FGGLTAV D ++L GEL GLIGPNGAGKTT+FNL++G Y+P+EG + + Sbjct: 13 VLEVRGLTQRFGGLTAVNDFNVKLMPGELSGLIGPNGAGKTTVFNLVSGFYQPTEGQIFV 72 Query: 63 DGHLLNGKSPYKIASLGLGRTFQNIRLFKDLTVLDNVLIAFGNHHKQHVFTSFLRLPAFY 122 DG P+++ +LG+ RTFQNIRL+ D+TVLDN+ +A F + +R + Sbjct: 73 DGKPTAALKPHRVTALGVARTFQNIRLWNDMTVLDNIRVAQHYQLGYGFFHAIVRSKHYR 132 Query: 123 KSEKELKAKALELLKIFDLDGDAETLAKNLSYGQQRRLEIVRALATEPKILFLDEPAAGM 182 E+++ +A ELL +FDL AE + KNL YG QR+LEI RAL++ PK+L LDEPAAG+ Sbjct: 133 TREEQVAKEAEELLDVFDLKRYAEEMPKNLPYGTQRKLEIARALSSHPKLLLLDEPAAGL 192 Query: 183 NPQETAELTELIRRIKDEFKITIMLIEHDMNLVMEVTERIYVLEYGRLIAQGTPDEIKTN 242 N + +L LIR I + F +TI +IEH M+++ME+ +I V+++G IA+G+ + ++ + Sbjct: 193 NSADAKDLIRLIRWIHETFDVTIWMIEHHMDVMMELCTQIKVIDFGETIAEGSAEHVRNH 252 Query: 243 KRVIEAYLGGE 253 V+ AYLG E Sbjct: 253 PAVMSAYLGDE 263 Lambda K H 0.319 0.139 0.385 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 200 Number of extensions: 3 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 254 Length of database: 265 Length adjustment: 24 Effective length of query: 230 Effective length of database: 241 Effective search space: 55430 Effective search space used: 55430 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory