Align L-serine ammonia-lyase (EC 4.3.1.17); D-Serine ammonia-lyase (EC 4.3.1.18) (characterized)
to candidate WP_092345208.1 BLU87_RS04710 D-cysteine desulfhydrase family protein
Query= BRENDA::O57809 (325 letters) >NCBI__GCF_900107645.1:WP_092345208.1 Length = 340 Score = 183 bits (464), Expect = 6e-51 Identities = 117/330 (35%), Positives = 170/330 (51%), Gaps = 19/330 (5%) Query: 14 RVELIPWETPIQYLPNISREIGADVYIKRDDLTGLGIGGNKIRKLEYLLGDALSKGADVV 73 RV+L TP+Q + +S G D+Y KRDD TG + GNK+RKLE+LL AL G D V Sbjct: 12 RVQLAQTPTPLQKMERLSDRFGVDIYFKRDDYTGTELSGNKVRKLEFLLHRALQMGVDTV 71 Query: 74 ITVGAVHSNHAFVTGLAAKKLGLDAILVLRGKE-----ELKGNYLLDKIMGIETRVYDAK 128 IT G SNH T AAK+LGL +L+LR + N LLD + T ++ Sbjct: 72 ITCGGAQSNHCRATAFAAKRLGLKTVLLLRTPNPAQPPATEANILLD-YLADATVIWITP 130 Query: 129 DSFELMK-YAEEIAEELKREGRKPYVIPPGGASPIGTLGYVRAVGEIATQ------SEVK 181 + ++ Y AE+L G PY+IP GG++ +G GYV AV E+ S Sbjct: 131 EQYQQRNLYFARQAEQLVAAGACPYIIPEGGSNALGAWGYVSAVEELVNDVKELDASVAA 190 Query: 182 FDSIVVAAGSGGTLAGLSLGLSILNEDIRPVGIAVGRFGEVMTSKLDNLIKEAAELLGVK 241 +++ A GSGGT AGL LG + R VG+ V E + ++ + E + Sbjct: 191 TTTVISAVGSGGTTAGLVLGNKLFAAGFRVVGVNVCDDREYFQRVIGTIMDDFQERYLPQ 250 Query: 242 VEVRP---ELYDYSFGE-YGKITGEVAQIIRKVGTREGIILDPVYTGKAFYGLVDLARKG 297 V P E+ D G+ Y + IR + EG++LDPVYTGKA++ ++ K Sbjct: 251 SIVSPADIEILDGYVGKGYALSQPAELEAIRDLARLEGVVLDPVYTGKAYFAMISELEKN 310 Query: 298 E--LGEKILFIHTGGISGTFHYGDKLLSLL 325 G +I+F+HTGG+ G F +++ ++L Sbjct: 311 PQCFGPRIVFVHTGGLFGLFSIAEQMAAVL 340 Lambda K H 0.319 0.142 0.402 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 248 Number of extensions: 10 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 325 Length of database: 340 Length adjustment: 28 Effective length of query: 297 Effective length of database: 312 Effective search space: 92664 Effective search space used: 92664 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory