Align 4-aminobutyrate aminotransferase; EC 2.6.1.19 (characterized, see rationale)
to candidate WP_092345303.1 BLU87_RS04965 ornithine--oxo-acid transaminase
Query= uniprot:A1S8Y2 (425 letters) >NCBI__GCF_900107645.1:WP_092345303.1 Length = 400 Score = 196 bits (499), Expect = 8e-55 Identities = 132/408 (32%), Positives = 202/408 (49%), Gaps = 43/408 (10%) Query: 26 VFTERAENATVWDVEGREYIDFAGGIAVLNTGHLHPKVKAAVAEQLEKFSHTCFMVLGYE 85 V R + VWDV+G +Y+D + +N GH HPK+ A+ Q EK + T + Sbjct: 23 VVLTRGKGVWVWDVDGNKYLDCLAAYSAVNQGHCHPKIMQAMVTQAEKLTLTSRAFRNDQ 82 Query: 86 S---YVAVCEKLNQLVPGDFAKKSALFTSGSEAVENAIKVARAY--------TKRAGVIA 134 Y +CE + + K SG+EAVE AIK R + +A +I Sbjct: 83 LGPFYQELCELTH-------SHKVLPMNSGAEAVETAIKTVRKWGYLVKGVPQDKAEIIV 135 Query: 135 FTSGYHGRTMAALALTGKVAPYSKGMGLMQANVFRAEFPCALHGVSEDDAMASIERIFKN 194 + +HGRT++ ++ + + G G F F C G DA A I N Sbjct: 136 CANNFHGRTISIVSFSTDENARA-GFG-----PFTPGFKCIPFG----DAAAFETAITAN 185 Query: 195 DAEPSDIAAIILEPVQGEGGFYAATPGFMKRLRELCDREGIMLIADEVQTGAGRTGTFFA 254 A ++EP+QGE G ++K++RE+ DR ++LI DE+QTG GRTG Sbjct: 186 TV------AFLVEPIQGEAGVIIPPDDYLKQVREISDRHNVVLILDEIQTGLGRTGKLLT 239 Query: 255 MEQMGVAADITTFAKSIAGGF-PLSGITGRAEVMDAIGPGGLGGTYGGSPLACAAALAVI 313 E G+ AD+T K+++GGF P+S + EVMD + PG G T+GG+PLACA A A + Sbjct: 240 EEYAGIEADLTLIGKALSGGFYPVSAVLSNTEVMDVLQPGEHGSTFGGNPLACAVARAAL 299 Query: 314 EVFEEEKLLERSNAIGQTIKSAIGELASRYPQIAEVRGLGSMIAIELMENGKPAPEYCPQ 373 +V EE L+E S G+ + + +++ +P I EVRG G M+AIE A YC + Sbjct: 300 KVLFEENLIENSYEQGEYFLNELKKIS--HPHIKEVRGRGLMLAIEFHPEVGGARGYCYK 357 Query: 374 VLTEARNRGLILLSCGTYGNVLRILVPITAPDEQIQRGLEIMAECFEA 421 + + +L+ T+ N++R P+ E++ LE + + A Sbjct: 358 LKEQG------ILAKDTHENIIRFAPPLVIKREEVDLILEAINQVLSA 399 Lambda K H 0.319 0.136 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 390 Number of extensions: 26 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 425 Length of database: 400 Length adjustment: 31 Effective length of query: 394 Effective length of database: 369 Effective search space: 145386 Effective search space used: 145386 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory