Align aminobutyraldehyde dehydrogenase (EC 1.2.1.19) (characterized)
to candidate WP_092345688.1 BLU87_RS05845 aldehyde dehydrogenase family protein
Query= BRENDA::B6ECN9 (505 letters) >NCBI__GCF_900107645.1:WP_092345688.1 Length = 477 Score = 298 bits (762), Expect = 4e-85 Identities = 173/474 (36%), Positives = 274/474 (57%), Gaps = 11/474 (2%) Query: 14 FIDGEWREPLKKNRLPIINPAN-EEIIGYIPAATEEDVDMAVKAARSALRRDDWGSTTGA 72 +I+GEW E N INP++ +IIG A E+ + A++AA++A R+ W Sbjct: 7 YINGEWVESNDVNL--DINPSDTNDIIGEYARADEQQTNDAIQAAKAA--RNVWRDVCVN 62 Query: 73 QRAKYLRAIAAKVLEKKPELATLETIDNGKPWFEAASDIDDVVACFEYYADLAEALDSKK 132 +++ L I +++L +K ELATL + GK EA ++ F++++ A L Sbjct: 63 EKSIILDNIGSEILARKTELATLLAREEGKTLPEATGEVVRAGMIFKFFSGEAVRLTGDI 122 Query: 133 QTEVKLHLDSFKTHVLREPLGVVGLITPWNYPLLMTTWKVAPALAAGCAAILKPSELASI 192 + L+ + REP+GV+G+I+PWN+P+ + WK+APALA G +LK ++L Sbjct: 123 LASTRPGLN---VEITREPVGVIGVISPWNFPIAIPAWKIAPALAFGNTVVLKSADLVPA 179 Query: 193 TSLELGEICREVGLPPGALSILTGLGHEAGSPLVSHPDVDKIAFTGSGPTGVKIMTAAAQ 252 ++ L EI GLP GA +++ G G + G +V+ PD+D + FTGS G I A Sbjct: 180 SAWALAEIISRAGLPAGAFNLVMGSGSKVGDTIVNSPDIDAVTFTGSDAIGNGIRGKVAG 239 Query: 253 LVKPVTLELGGKSPIVVFDDIHNLDTAVEWTLFGCFWTNGQICSATSRLIIQETIAPQFL 312 V LE+GGK+P+VV DD +LDTA+ + G F+ GQ C+A+SRLI+ E I F+ Sbjct: 240 RGAKVQLEMGGKNPLVVLDDA-DLDTAINAAVDGAFFGTGQRCTASSRLIVTEGIHDAFV 298 Query: 313 ARLLEWTKNIKISDPLEEDCKLGPVISRGQYEKILKFISTAKDEGATILYGGDRPEHLKK 372 A ++E + ++ L+ ++GPV S+ Q + L++IS K+EGA + YGG+ + Sbjct: 299 AGVIERLQGLRTGHALDSKSQIGPVSSQAQLQTDLEYISIGKEEGAHLAYGGELLQRDTP 358 Query: 373 GYYIQPTIITDVDTSMEIWKEEVFGPVLCVKTFKTEEEAIELANDTKFGLGAAILSKDLE 432 GYY+ P + T+ D M + +EEVFGPV V K EEA+ELANDT+FGL + I + LE Sbjct: 359 GYYLSPALFTETDNDMRLNREEVFGPVATVIRAKNYEEALELANDTRFGLTSGICTTSLE 418 Query: 433 RCERFTKAFQSGIVWINC-SQPCFWQPPWGGKKRSGFG-RELGEWSLENYLNIK 484 + F + ++G+V +N + + P+GG+K S +G RE G ++ E + +K Sbjct: 419 SSKDFKRNSEAGMVMVNLPTAGIDYHVPFGGRKNSSYGSREQGSYAREFFTIVK 472 Lambda K H 0.318 0.136 0.421 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 565 Number of extensions: 25 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 505 Length of database: 477 Length adjustment: 34 Effective length of query: 471 Effective length of database: 443 Effective search space: 208653 Effective search space used: 208653 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory