GapMind for catabolism of small carbon sources

 

Protein WP_092345972.1 in Desulfuromusa kysingii DSM 7343

Annotation: NCBI__GCF_900107645.1:WP_092345972.1

Length: 333 amino acids

Source: GCF_900107645.1 in NCBI

Candidate for 9 steps in catabolism of small carbon sources

Pathway Step Score Similar to Id. Cov. Bits Other hit Other id. Other bits
4-hydroxybenzoate catabolism pta hi phosphate acetyltransferase (EC 2.3.1.8) (characterized) 54% 99% 325.1
4-hydroxybenzoate catabolism pta hi pta: phosphate acetyltransferase (EC 2.3.1.8) (TIGR00651) 100% 383.7
L-lactate catabolism pta hi phosphate acetyltransferase (EC 2.3.1.8) (characterized) 54% 99% 325.1
L-lactate catabolism pta hi pta: phosphate acetyltransferase (EC 2.3.1.8) (TIGR00651) 100% 383.7
acetate catabolism pta hi phosphate acetyltransferase (EC 2.3.1.8) (characterized) 54% 99% 325.1
acetate catabolism pta hi pta: phosphate acetyltransferase (EC 2.3.1.8) (TIGR00651) 100% 383.7
2'-deoxyinosine catabolism pta hi phosphate acetyltransferase (EC 2.3.1.8) (characterized) 54% 99% 325.1
2'-deoxyinosine catabolism pta hi pta: phosphate acetyltransferase (EC 2.3.1.8) (TIGR00651) 100% 383.7
2-deoxy-D-ribose catabolism pta hi phosphate acetyltransferase (EC 2.3.1.8) (characterized) 54% 99% 325.1
2-deoxy-D-ribose catabolism pta hi pta: phosphate acetyltransferase (EC 2.3.1.8) (TIGR00651) 100% 383.7
ethanol catabolism pta hi phosphate acetyltransferase (EC 2.3.1.8) (characterized) 54% 99% 325.1
ethanol catabolism pta hi pta: phosphate acetyltransferase (EC 2.3.1.8) (TIGR00651) 100% 383.7
L-threonine catabolism pta hi phosphate acetyltransferase (EC 2.3.1.8) (characterized) 54% 99% 325.1
L-threonine catabolism pta hi pta: phosphate acetyltransferase (EC 2.3.1.8) (TIGR00651) 100% 383.7
thymidine catabolism pta hi phosphate acetyltransferase (EC 2.3.1.8) (characterized) 54% 99% 325.1
thymidine catabolism pta hi pta: phosphate acetyltransferase (EC 2.3.1.8) (TIGR00651) 100% 383.7
L-tryptophan catabolism pta hi phosphate acetyltransferase (EC 2.3.1.8) (characterized) 54% 99% 325.1
L-tryptophan catabolism pta hi pta: phosphate acetyltransferase (EC 2.3.1.8) (TIGR00651) 100% 383.7

Sequence Analysis Tools

View WP_092345972.1 at NCBI

Find papers: PaperBLAST

Find functional residues: SitesBLAST

Search for conserved domains

Find the best match in UniProt

Compare to protein structures

Predict transmenbrane helices: Phobius

Predict protein localization: PSORTb

Find homologs in fast.genomics

Fitness BLAST: loading...

Sequence

MHLVDQIKAKACANLQTVVLPEGYDDRMVEASARIVVAKLAHVVLLGNPQTLNAKALELG
VSLAHVEIVDPATDARLDAYANELMELRKHKGLTYDEAVALLTAGDNLYFATMMVRKGDA
GGAVAGADNTTGNVLRSALQVIGTAPGMNTVSSVFLMVTDNPDLGESGTLCFADCAVNPN
PDAHALAEIAVSTAASCKSFLGVDARVAMLSFSTKGSAVHEDCDKVLTALNIAKELAPEL
AIDGELQLDAALITSVGNKKAPGSKVAGHANTLIFPDLDAGNIGYKLVERIAGAEAVGPI
IQGLAKPVNDLSRGCSVEDIVSVAAITAVQAQG

This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory