Align acetate kinase (EC 2.7.2.15) (characterized)
to candidate WP_092346787.1 BLU87_RS08545 cupin domain-containing protein
Query= metacyc::STM2468-MONOMER (229 letters) >NCBI__GCF_900107645.1:WP_092346787.1 Length = 152 Score = 103 bits (256), Expect = 2e-27 Identities = 53/147 (36%), Positives = 86/147 (58%), Gaps = 4/147 (2%) Query: 83 ESLVAQLMEKVLKEKQSLELGTMQPSFTSVTGKGGVKVIDGSSVKFGRFD-GAEPHCVGL 141 + L+ ++ +V+ E+ LE+ + V + GV + + VK FD G E V L Sbjct: 8 KDLLRTIIREVIAEQSQLEIAHFEKK---VDKQSGVTAVRAAEVKPKPFDTGKEGDKVFL 64 Query: 142 TDLVTEQDGSSMAAGFMQWDNAFFPWTLNYDEIDMVLEGELHVRHEGETMIAKAGDVMFI 201 TDL T + + +G M+ +++ F W L YDEID V+EG L + +G ++ +AGDV+ I Sbjct: 65 TDLFTLDESPRLGSGIMEMESSCFDWVLKYDEIDYVIEGRLEIIIDGRKIVGEAGDVILI 124 Query: 202 PKGSSIEFGTPTSVRFLYVAWPANWQS 228 PK ++I+F P RFLYV +PA+W++ Sbjct: 125 PKDTAIQFSVPEFARFLYVTYPADWEN 151 Lambda K H 0.317 0.131 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 93 Number of extensions: 4 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 229 Length of database: 152 Length adjustment: 20 Effective length of query: 209 Effective length of database: 132 Effective search space: 27588 Effective search space used: 27588 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 44 (21.6 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory