Align Aspartate aminotransferase; AAT; AspAT; Putative 2-aminoadipate transaminase; Transaminase A; EC 2.6.1.1; EC 2.6.1.39 (characterized)
to candidate WP_092346870.1 BLU87_RS08685 pyridoxal phosphate-dependent aminotransferase
Query= SwissProt::P58350 (410 letters) >NCBI__GCF_900107645.1:WP_092346870.1 Length = 390 Score = 202 bits (514), Expect = 1e-56 Identities = 116/364 (31%), Positives = 202/364 (55%), Gaps = 14/364 (3%) Query: 43 VIILGAGEPDFDTPEHVKQAASDAIHRGETKYTALDGTPELKKAIREKFQRENGLAYELD 102 V+ L GEPDF TP H+ +AA +I G+T+Y+ G EL++A+ +K+ ++ D Sbjct: 33 VVNLCNGEPDFSTPSHICEAAIASIQGGDTRYSPTSGILELRQAVADKYTQQLKRRITPD 92 Query: 103 EITVATGAKQILFNAMMASLDPGDEVIIPTPYWTSYSDIVHICEGKPVLIACDASSGFRL 162 + + G + L +++A+++PGDEVI+ P + +Y + + + K V I + F++ Sbjct: 93 NVMIVCGGTEALMMSLLATVNPGDEVIVTDPCYPNYFAQIELVKAKCVSIPVYEKNNFQI 152 Query: 163 TAEKLEAAITPRTRWVLLNSPSNPSGAAYSAADYRPLLEVLLRHPHVWLLVDDMYEHIVY 222 E L+ AI+ RT+ ++LN P+NP G ++ +Y LE L+ ++ + D++YE + Y Sbjct: 153 DPEDLKKAISSRTKGIILNYPNNPLGVT-ASEEYIQSLEQLIDDNNLIVFSDEVYESLTY 211 Query: 223 DGFRFVTPAQLEPGLKNRTLTVNGVSKAYAMTGWRIGYAGGPRELIKAMAVVQSQATSCP 282 + AQ +K+ L +N +SK YAMTGWRIGY G +++K+M +Q SC Sbjct: 212 GKSGHYSLAQ-NDRIKDNVLVMNSLSKTYAMTGWRIGYIVGHPKIMKSMFRLQESVLSCL 270 Query: 283 SSISQAASVAALNGPQDFLKERTESFQRRRDLVVNGLNAIDGLDCRVPEGAFYTFSGCAG 342 Q A++AAL G QD ++E ++++R +L+V+G+ ++ G C P G + + Sbjct: 271 PVFIQKAALAALRGSQDKVQEMASAYEKRMNLLVDGIQSMPGFKCIRPMGGLCVMANISA 330 Query: 343 VLGKVTPSGKRIKTDTDFCAYLLEDAHVAVVPGSAFGL--SPFFRISYATSEAELKEALE 400 K+ +F LLE+A V VPGSAFG + R +A S +++ +E Sbjct: 331 Y----------NKSSEEFSRELLENAGVMTVPGSAFGPMGEGYIRFCFANSFENIQKGVE 380 Query: 401 RIAA 404 R+++ Sbjct: 381 RLSS 384 Lambda K H 0.318 0.134 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 367 Number of extensions: 15 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 1 Length of query: 410 Length of database: 390 Length adjustment: 31 Effective length of query: 379 Effective length of database: 359 Effective search space: 136061 Effective search space used: 136061 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory