Align C4-dicarboxylate TRAP transporter large permease protein DctM (characterized)
to candidate WP_092346873.1 BLU87_RS08690 TRAP transporter large permease
Query= SwissProt::Q9HU16 (427 letters) >NCBI__GCF_900107645.1:WP_092346873.1 Length = 428 Score = 338 bits (868), Expect = 1e-97 Identities = 176/427 (41%), Positives = 272/427 (63%), Gaps = 2/427 (0%) Query: 1 MTILFLFLLLFLLMFIGVPIAVSLGLSGALTILLFSPDSVRSLAIKLFETSEHYTLLAIP 60 M L + + L +F+G+PIA LG++G L ++LF + L +++ + LA+P Sbjct: 1 METLSIVGVFILTLFLGMPIAFVLGITG-LVMVLFIDVPLVVLPNRMWSQLGTFPFLAVP 59 Query: 61 FFLLSGAFMTTGGVARRLIDFANACVGHIRGGLAIAAVLACMLFAALSGSSPATVAAVGS 120 FF+L+G M G+ +RL+ FAN VG IRGGL ++A MLFA ++GS+ AA+GS Sbjct: 60 FFILAGEIMNEAGITQRLVSFANLLVGRIRGGLGQVNIIASMLFAGITGSAIGDTAALGS 119 Query: 121 IAIAGMVRSGYPQAFGAGIVCNAGTLGILIPPSIVMVVYAAATETSVGKLFIAGVVPGLL 180 I I M + GY + F + ++ +G +IPPS++M++ A E S+G LF+AG VPG+L Sbjct: 120 IMIPAMEKEGYDKDFSVAVTASSSIIGPIIPPSLLMIILGVAAEQSIGTLFVAGYVPGIL 179 Query: 181 LGLILMVVIYIVARVKKLP-AMPRVSLREWLASARKALWGLLLMVIILGGIYSGAFTPTE 239 +G+ LM++ Y ++ + R S R+ L RKAL LL+ +II+ GI +G FT TE Sbjct: 180 IGVSLMILTYFISIKRNYTFRAERTSFRQGLIIFRKALIPLLMPIIIIVGILAGIFTATE 239 Query: 240 AAAVAAVYSAFVALFVYRDMRLSECPKVLLESGKLTIMLMFIIANAMLFAHVLTTEQIPQ 299 AAAVA VY+ FV LFV + ++L P + + S LT L I++ + + +T Q+ + Sbjct: 240 AAAVACVYALFVGLFVTKTLKLKRLPDLFIRSALLTASLHLIVSMSGISGFAVTVLQLAE 299 Query: 300 SIASWVTELGLSPWMFLLVVNIVLLIAGNFMEPSAIILILAPIFFPIAMELGIDPIHLGI 359 +++ VT+ +P++ LL++NIVLLI G FMEP+ I+IL PI FP+ LGI P+H GI Sbjct: 300 KMSAAVTQFSTNPFVILLLLNIVLLIIGMFMEPTVSIIILVPILFPMIEALGIHPVHFGI 359 Query: 360 IMVVNMEIGLITPPVGLNLFVTSAVTGMPLGATIRAALPWLMILLVFLIIVTYIPAVSLA 419 IM++N+ IG+ TPP+GL LF S+V +P+ + A P+L+I V L+++TYIPA++L Sbjct: 360 IMLMNLTIGVATPPLGLVLFTASSVGKIPVERVVMAIWPFLLIEFVVLLLITYIPALTLT 419 Query: 420 LPNWLGM 426 +P WLG+ Sbjct: 420 IPRWLGL 426 Lambda K H 0.330 0.144 0.425 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 508 Number of extensions: 23 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 427 Length of database: 428 Length adjustment: 32 Effective length of query: 395 Effective length of database: 396 Effective search space: 156420 Effective search space used: 156420 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory