Align High-affinity branched-chain amino acid transport system permease protein BraD, component of Branched chain amino acid uptake transporter. Transports alanine (characterized)
to candidate WP_092347352.1 BLU87_RS09505 branched-chain amino acid ABC transporter permease
Query= TCDB::P21627 (307 letters) >NCBI__GCF_900107645.1:WP_092347352.1 Length = 286 Score = 166 bits (420), Expect = 6e-46 Identities = 101/295 (34%), Positives = 158/295 (53%), Gaps = 13/295 (4%) Query: 7 YLQQLVNGLTVGSTYALIAIGYTMVYGIIGMINFAHGEVYMIGSYIAFIAITLLAMMGLD 66 +LQ L +G+T+G+ YALIA+G+ +V +G++NF + +G + F A L GL Sbjct: 5 FLQYLFSGITIGAIYALIALGFCVVNNTMGIVNFVQVDFVSLGGMLMFSA---LLTAGLP 61 Query: 67 SVPLMMLAAFAASIIVTSAFGYSIERVAYRPLRGGNRLIPLISAIGMSIFLQNAVMLSQD 126 +P ++L+ +++ +ER RP R N L+ + +G+SI L+ + L Sbjct: 62 MIPGLLLSVSGVALVAML-----VERFGLRPARSDNHLVLIFLTVGLSIILRGIIKLVWG 116 Query: 127 SKEKAIPTLLPGNFVFGESSMNGVVISYMQILIFVVTFLVMFGLTLFISRSRLGRACRAC 186 A+P L P V + G + + I +T L + LT F R+ LG + RA Sbjct: 117 KNRMALPPLTPDVPV----QIFGASVLPQALWILFLTVLAIGLLTWFFYRTSLGLSMRAV 172 Query: 187 AEDLKMTNLLGINSNNIIALTFVIGAALAAVAAVLLGMQYGVINPGIGFLAGIKAFTAAV 246 A + ++GI + + ++ I AL +A VL+ ++ +G L G+K F AA+ Sbjct: 173 ASNPTAAAVVGIPAGRVRLTSYAIAGALGGLAGVLV-TPITTLSYDVGVLLGLKGFAAAI 231 Query: 247 LGGIGSIPGAMLGGLLLGVAEAFGADVFGDQYKDVVAFGLLILVLLFRPTGILGR 301 LGG GS PGA+LGGL LG+ E+ A YKDVVAF +L+LVL RP G+LG+ Sbjct: 232 LGGFGSFPGAILGGLGLGLLESLSAGYISSAYKDVVAFVVLLLVLFVRPKGLLGK 286 Lambda K H 0.328 0.145 0.413 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 284 Number of extensions: 13 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 307 Length of database: 286 Length adjustment: 26 Effective length of query: 281 Effective length of database: 260 Effective search space: 73060 Effective search space used: 73060 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory