Align glycine betaine-binding periplasmic protein (characterized)
to candidate WP_092348024.1 BLU87_RS10695 proline/glycine betaine ABC transporter substrate-binding protein ProX
Query= CharProtDB::CH_024698 (330 letters) >NCBI__GCF_900107645.1:WP_092348024.1 Length = 339 Score = 236 bits (602), Expect = 6e-67 Identities = 124/316 (39%), Positives = 171/316 (54%), Gaps = 20/316 (6%) Query: 25 PGKGITVNPVQSTITEETFQTLLVSRALEKLGYTVNKPSEVDYNVGYTSLASGDATFTAV 84 PGKG V P ++T FQ LV L++LGY V KP E+ + Y SLA GD + Sbjct: 24 PGKGTKVQPARATWNTGYFQEALVRTGLKELGYNVKKPKELTNPLFYQSLALGDLDYWTN 83 Query: 85 NWTPLHDNMYEAAGGDKKFYREG-----VFVNGAAQGYLIDKKTADQYKITNIAQLKDPK 139 W P+HD A K FY +G V +G QGYL+ KK +++ I ++ K P+ Sbjct: 84 GWFPMHD-----AQMPKDFYSKGEKVGYVAKSGGLQGYLVSKKEVEKFNIKSLDDFKRPE 138 Query: 140 IAKLFDTNGDGKADLTGCNPGWGCEGAINHQLAAYELTNTVTHNQGNYAAMMADTISRYK 199 + FD NGDGKADLT C GW CEG I H + Y L + + + Y+A MAD+++RY Sbjct: 139 VKAAFDANGDGKADLTACPAGWACEGVIAHHMEVYGLEDDINLIKAAYSASMADSLARYN 198 Query: 200 EGKPVFYYTWTPYWVSNELKPGKDVVWLQVP-FSALPGDKNADTKL---------PNGAN 249 G P F+YTW P W + PGKDV+W+ VP +++ +L + Sbjct: 199 SGGPAFFYTWAPNWTIFKFMPGKDVMWINVPEIKPTEAQQSSIERLTATGIEGAVSDPVK 258 Query: 250 YGFPVSTMHIVANKAWAEKNPAAAKLFAIMQLPVADINAQNAIMHDGKASEGDIQGHVDG 309 GF + + IVANK + NPAA + F + LP++DIN QN M DG+ S DI HV Sbjct: 259 LGFVAADIQIVANKKFLAANPAAKEFFRVFNLPLSDINEQNTKMQDGEKSAKDIDRHVKE 318 Query: 310 WIKAHQQQFDGWVNEA 325 WI +Q ++DGW+ A Sbjct: 319 WIAKNQDKWDGWLAAA 334 Lambda K H 0.315 0.131 0.400 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 393 Number of extensions: 16 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 330 Length of database: 339 Length adjustment: 28 Effective length of query: 302 Effective length of database: 311 Effective search space: 93922 Effective search space used: 93922 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory