Align Phosphate acetyltransferase; EC 2.3.1.8; Phosphotransacetylase (uncharacterized)
to candidate WP_092348112.1 BLU87_RS10845 NADP-dependent malic enzyme
Query= curated2:Q59330 (328 letters) >NCBI__GCF_900107645.1:WP_092348112.1 Length = 752 Score = 219 bits (557), Expect = 2e-61 Identities = 132/329 (40%), Positives = 191/329 (58%), Gaps = 10/329 (3%) Query: 3 IIQSIIEKAKSNKKKIVLPEGAEPRTLKAADIVLKEGIADLVLLGNADEIRNAAEG--LD 60 +++++I KAK+N K+IV PEG + + L+AA I++ E IA +LLG+ IR+ E L+ Sbjct: 427 VMRTLINKAKANPKRIVFPEGEDDKILRAAQILVNEKIAIPILLGDEKLIRDRIEEMKLE 486 Query: 61 ISKAEIIDPLKSEKFDKYATDFYELRKNKGITLEKAKETIK-DNIYFGCMMVKEGYADGL 119 + +I+DP + D Y E+R+ KGIT AK ++ +N YFG MMV+ G AD + Sbjct: 487 LGDIQILDPRECVNCDIYVEKLLEIRQRKGITPTGAKRRMRSNNNYFGAMMVQNGDADTM 546 Query: 120 VSGAIHATADLLRPAFQIVKTAPGAKIVSSFFIMEVPNCEFGENGVFLFADCAVNPSPNA 179 +SG H + ++PA +I+ V ++M F + VF+ AD V P A Sbjct: 547 LSGISHHYPETIKPALEIIGKHEELSKVHGMYMMV-----FKKKVVFI-ADATVTIDPTA 600 Query: 180 EELASIAVQSANTAKTLLGMEPRVAMLSFSTKGSASHELVDKVRTATEIAKNLIPDVAID 239 EELA A+ +A + + P+VAMLSFS GS SH KV+ AT + K PD+ ID Sbjct: 601 EELAETAILTAEEVRKF-DIVPKVAMLSFSNFGSTSHPFAAKVKKATALVKEQAPDLIID 659 Query: 240 GELQLDAALVKEVAELKAPGSPVAGRANVLIFPDLQAGNIGYKLVQRLAKANAIGPITQG 299 GE+Q + AL E+ + P S + G ANV IFPDLQ+GNI YKL+ +L A A+GPI G Sbjct: 660 GEIQANVALDPELMANQYPFSMLKGDANVFIFPDLQSGNISYKLLSKLGGAEAVGPILMG 719 Query: 300 MGAPVNDLSRGCSYKDIVDVIATTAVQAQ 328 PV+ L RG D++++ A V AQ Sbjct: 720 TKKPVHVLQRGDDVADVINMAAVAVVDAQ 748 Lambda K H 0.315 0.133 0.365 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 546 Number of extensions: 29 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 328 Length of database: 752 Length adjustment: 34 Effective length of query: 294 Effective length of database: 718 Effective search space: 211092 Effective search space used: 211092 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory