Align AapM, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized)
to candidate WP_092348288.1 BLU87_RS11125 amino acid ABC transporter permease
Query= TCDB::Q52814 (384 letters) >NCBI__GCF_900107645.1:WP_092348288.1 Length = 317 Score = 125 bits (314), Expect = 2e-33 Identities = 77/209 (36%), Positives = 117/209 (55%), Gaps = 9/209 (4%) Query: 170 PLWGGLMVTLVLSFVGIAVSLPVGILLALGRRSRMPVIRMLCVTFIEVIRGVPLITVLFM 229 PL GL VTL +S + + L +G++ L R S+ +R L +T+IE+IRG PL+ LF+ Sbjct: 114 PLVTGLWVTLWISALASIIGLVIGVVTGLCRVSKNLTLRQLSITYIELIRGTPLLVQLFI 173 Query: 230 ASVMLPLFLPTGWNVDKLLRALIGVSIFTSAYMAEVIRGGLQAIPKGQFEGADSLGLGYW 289 FL T ++ +L + ++IF AY+AE+IR G+Q+IPKGQ E A SLG+ Sbjct: 174 ----FYFFLGTVLDIGRLASGIFALAIFAGAYVAEIIRAGIQSIPKGQMEAARSLGMNVP 229 Query: 290 QKTRLIIMPQAIKLVIPSIVNTFIGTFKDTSLVTIIGMFDLLGIVKLNFSDANWASAVTP 349 Q II+PQA K +P + FI KD+SLV++I + DL K AV Sbjct: 230 QAMIYIILPQAFKRTLPPLAGQFISLIKDSSLVSVIAITDL---TKSGREVITSTFAVFE 286 Query: 350 ITGLIFAGFIFWLFCFGMSRYSGFMERHL 378 I ++ F++ + F +S+ ++ER L Sbjct: 287 IWFVV--AFLYLILTFSLSQVVAWVERRL 313 Lambda K H 0.330 0.145 0.469 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 335 Number of extensions: 15 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 1 Length of query: 384 Length of database: 317 Length adjustment: 29 Effective length of query: 355 Effective length of database: 288 Effective search space: 102240 Effective search space used: 102240 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory