Align ABC transporter ATP-binding protein-branched chain amino acid transport, component of The branched chain hydrophobic amino acid transporter, LivJFGHM (characterized)
to candidate WP_092348686.1 BLU87_RS11820 ABC transporter ATP-binding protein
Query= TCDB::Q8DQH8 (254 letters) >NCBI__GCF_900107645.1:WP_092348686.1 Length = 266 Score = 269 bits (688), Expect = 4e-77 Identities = 140/256 (54%), Positives = 181/256 (70%), Gaps = 5/256 (1%) Query: 3 LLEVKQLTKHFGGLTAVGDVTLELNEGELVGLIGPNGAGKTTLFNLLTGVYEPSEGTVTL 62 LLEVK LT FGGL AV V+LE++EGE+ LIGPNGAGKTT FN +TG+Y P++G + L Sbjct: 8 LLEVKGLTMDFGGLRAVDSVSLEVHEGEIAALIGPNGAGKTTFFNCVTGIYNPTKGDILL 67 Query: 63 -----DGHLLNGKSPYKIASLGLGRTFQNIRLFKDLTVLDNVLIAFGNHHKQHVFTSFLR 117 + LNG P K+ +GL RTFQNIRLF D+TVL+NV+I K +F + LR Sbjct: 68 HPKGLETRRLNGLKPNKVTEMGLARTFQNIRLFPDMTVLENVMIGRHCRTKAGIFRAILR 127 Query: 118 LPAFYKSEKELKAKALELLKIFDLDGDAETLAKNLSYGQQRRLEIVRALATEPKILFLDE 177 + E+ + + +LL+ L+ A +KNL YG QRRLEI RA+AT+P +L LDE Sbjct: 128 DKGVREEEQLIVESSYQLLEKVGLEDFANEFSKNLPYGAQRRLEIARAMATDPFLLLLDE 187 Query: 178 PAAGMNPQETAELTELIRRIKDEFKITIMLIEHDMNLVMEVTERIYVLEYGRLIAQGTPD 237 PAAGMNPQETA+L +LIR+I +E KI I+LIEHDM LVM ++ IYV+EYG+ IA+G+P Sbjct: 188 PAAGMNPQETADLDQLIRKISEEEKIAILLIEHDMKLVMHISNPIYVMEYGKKIAEGSPQ 247 Query: 238 EIKTNKRVIEAYLGGE 253 EIK N +V+EAYLG E Sbjct: 248 EIKDNPKVVEAYLGEE 263 Lambda K H 0.319 0.139 0.385 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 207 Number of extensions: 3 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 254 Length of database: 266 Length adjustment: 24 Effective length of query: 230 Effective length of database: 242 Effective search space: 55660 Effective search space used: 55660 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory