Align High-affinity branched-chain amino acid transport ATP-binding protein LivG aka B3455, component of Leucine; leucine/isoleucine/valine porter (characterized)
to candidate WP_092348686.1 BLU87_RS11820 ABC transporter ATP-binding protein
Query= TCDB::P0A9S7 (255 letters) >NCBI__GCF_900107645.1:WP_092348686.1 Length = 266 Score = 261 bits (668), Expect = 8e-75 Identities = 131/255 (51%), Positives = 179/255 (70%), Gaps = 5/255 (1%) Query: 5 LLSVNGLMMRFGGLLAVNNVNLELYPQEIVSLIGPNGAGKTTVFNCLTGFYKPTGGTILL 64 LL V GL M FGGL AV++V+LE++ EI +LIGPNGAGKTT FNC+TG Y PT G ILL Sbjct: 8 LLEVKGLTMDFGGLRAVDSVSLEVHEGEIAALIGPNGAGKTTFFNCVTGIYNPTKGDILL 67 Query: 65 RDQHLE-----GLPGQQIARMGVVRTFQHVRLFREMTVIENLLVAQHQQLKTGLFSGLLK 119 + LE GL ++ MG+ RTFQ++RLF +MTV+EN+++ +H + K G+F +L+ Sbjct: 68 HPKGLETRRLNGLKPNKVTEMGLARTFQNIRLFPDMTVLENVMIGRHCRTKAGIFRAILR 127 Query: 120 TPSFRRAQSEALDRAATWLERIGLLEHANRQASNLAYGDQRRLEIARCMVTQPEILMLDE 179 R + ++ + LE++GL + AN + NL YG QRRLEIAR M T P +L+LDE Sbjct: 128 DKGVREEEQLIVESSYQLLEKVGLEDFANEFSKNLPYGAQRRLEIARAMATDPFLLLLDE 187 Query: 180 PAAGLNPKETKELDELIAELRNHHNTTILLIEHDMKLVMGISDRIYVVNQGTPLANGTPE 239 PAAG+NP+ET +LD+LI ++ ILLIEHDMKLVM IS+ IYV+ G +A G+P+ Sbjct: 188 PAAGMNPQETADLDQLIRKISEEEKIAILLIEHDMKLVMHISNPIYVMEYGKKIAEGSPQ 247 Query: 240 QIRNNPDVIRAYLGE 254 +I++NP V+ AYLGE Sbjct: 248 EIKDNPKVVEAYLGE 262 Lambda K H 0.320 0.137 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 190 Number of extensions: 5 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 255 Length of database: 266 Length adjustment: 24 Effective length of query: 231 Effective length of database: 242 Effective search space: 55902 Effective search space used: 55902 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory