Align High-affinity branched-chain amino acid transport ATP-binding protein BraF, component of Branched chain amino acid uptake transporter. Transports alanine (characterized)
to candidate WP_092348686.1 BLU87_RS11820 ABC transporter ATP-binding protein
Query= TCDB::P21629 (255 letters) >NCBI__GCF_900107645.1:WP_092348686.1 Length = 266 Score = 252 bits (643), Expect = 6e-72 Identities = 126/255 (49%), Positives = 172/255 (67%), Gaps = 5/255 (1%) Query: 5 ILEVSGLTMRFGGLLAVNGVNLKVEEKQVVSMIGPNGAGKTTVFNCLTGFYQPTGGLIRL 64 +LEV GLTM FGGL AV+ V+L+V E ++ ++IGPNGAGKTT FNC+TG Y PT G I L Sbjct: 8 LLEVKGLTMDFGGLRAVDSVSLEVHEGEIAALIGPNGAGKTTFFNCVTGIYNPTKGDILL 67 Query: 65 -----DGEEIQGLPGHKIARKGVVRTFQNVRLFKEMTAVENLLVAQHRHLNTNFLAGLFK 119 + + GL +K+ G+ RTFQN+RLF +MT +EN+++ +H + + Sbjct: 68 HPKGLETRRLNGLKPNKVTEMGLARTFQNIRLFPDMTVLENVMIGRHCRTKAGIFRAILR 127 Query: 120 TPAFRRSEREAMEYAAHWLEEVNLTEFANRSAGTLAYGQQRRLEIARCMMTRPRILMLDE 179 R E+ +E + LE+V L +FAN + L YG QRRLEIAR M T P +L+LDE Sbjct: 128 DKGVREEEQLIVESSYQLLEKVGLEDFANEFSKNLPYGAQRRLEIARAMATDPFLLLLDE 187 Query: 180 PAAGLNPKETDDLKALIAKLRSEHNVTVLLIEHDMKLVMSISDHIVVINQGAPLADGTPE 239 PAAG+NP+ET DL LI K+ E + +LLIEHDMKLVM IS+ I V+ G +A+G+P+ Sbjct: 188 PAAGMNPQETADLDQLIRKISEEEKIAILLIEHDMKLVMHISNPIYVMEYGKKIAEGSPQ 247 Query: 240 QIRDNPDVIKAYLGE 254 +I+DNP V++AYLGE Sbjct: 248 EIKDNPKVVEAYLGE 262 Lambda K H 0.320 0.137 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 194 Number of extensions: 6 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 255 Length of database: 266 Length adjustment: 24 Effective length of query: 231 Effective length of database: 242 Effective search space: 55902 Effective search space used: 55902 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory