Align High-affinity branched-chain amino acid transport system permease protein BraE, component of Branched chain amino acid uptake transporter. Transports alanine (characterized)
to candidate WP_092348689.1 BLU87_RS11825 high-affinity branched-chain amino acid ABC transporter permease LivM
Query= TCDB::P21628 (417 letters) >NCBI__GCF_900107645.1:WP_092348689.1 Length = 405 Score = 320 bits (820), Expect = 5e-92 Identities = 178/417 (42%), Positives = 258/417 (61%), Gaps = 22/417 (5%) Query: 1 MSQSLKRALFSALLVILVSYPILGLKLRTVGIKLEVLGADAQTLWTIAAAALAMFVWQLF 60 M Q+LK++L +L + +++P++ +++ T+ V+ LW A+ + ++W+ Sbjct: 1 MLQNLKQSLIVSLWFVFLTFPLMVIRVNTMD--QVVVWRWMNMLWVALASFILSYLWRYM 58 Query: 61 RDRIPLKLGRGVGYKVNGSGLKNFLSLPSTQRWAVLALVVVAFVWPFFASRGAVDIATLI 120 R ++ S L+ L S + A+ L++ A ++P I Sbjct: 59 LTRQQMRKAVAEEGGETRSKLQLLLEDMSFRYKAMGVLLLAALIFPQVFDTYQSTIMISA 118 Query: 121 LIYVMLGIGLNIVVGLAGLLDLGYVGFYAVGAYTYALLAEYAGFGFWTALPIAGMMAALF 180 LIYV+LG+GLNI VGLAGLLDLGYV F+ VGAY+YALL + GFW LPI G++ LF Sbjct: 119 LIYVVLGLGLNISVGLAGLLDLGYVAFFGVGAYSYALLNHHFDLGFWITLPIGGIIGCLF 178 Query: 181 GFLLGFPVLRLRGDYLAIVTLGFGEIIRILLRNMTEITGGPNGIGSIPKPTLFGLTFERR 240 G +LGFP+LRLRGDYLAIVTLGFG I ++++ N + ++ GP+GI +I KP+ FG+ Sbjct: 179 GVVLGFPILRLRGDYLAIVTLGFGMIFKVVMENWSSLSFGPSGIANIDKPSFFGMD---- 234 Query: 241 APEGMQTFHEFFGIAYNTNYKVILLYVVALLLVLLALFVINRLMRMPIGRAWEALREDEV 300 +A +T Y +Y + + LV+ + V NRL IGRAW A+REDE+ Sbjct: 235 -----------LSLADSTIY----IYYIMIALVIFTILVTNRLKNSRIGRAWIAMREDEI 279 Query: 301 ACRALGLNPTIVKLSAFTIGASFAGFAGSFFAARQGLVTPESFTFIESAMILAIVVLGGM 360 AC A+G++ KLSA+ +GA +AG G FA++ + P SFTF+ESA+IL+IVVLGGM Sbjct: 280 ACVAMGIDMARTKLSAYALGAFWAGMVGVLFASKTTFINPASFTFMESAIILSIVVLGGM 339 Query: 361 GSQLGVILAAVVMVLLQE-MRGFNEYRMLIFGLTMIVMMIWRPQGLLPMQRPHLELK 416 GS LGVIL A +++LL E MR F+EYRML FG M++MMI+RPQG++ R + K Sbjct: 340 GSILGVILGAFILILLPEYMRAFSEYRMLAFGAAMVIMMIFRPQGIISNLRQTYQYK 396 Lambda K H 0.330 0.146 0.439 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 529 Number of extensions: 37 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 417 Length of database: 405 Length adjustment: 31 Effective length of query: 386 Effective length of database: 374 Effective search space: 144364 Effective search space used: 144364 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory