Align High-affinity branched-chain amino acid transport system permease protein BraD, component of Branched chain amino acid uptake transporter. Transports alanine (characterized)
to candidate WP_092348693.1 BLU87_RS11830 branched-chain amino acid ABC transporter permease LivH
Query= TCDB::P21627 (307 letters) >NCBI__GCF_900107645.1:WP_092348693.1 Length = 300 Score = 306 bits (784), Expect = 4e-88 Identities = 161/302 (53%), Positives = 216/302 (71%), Gaps = 4/302 (1%) Query: 6 HYLQQLVNGLTVGSTYALIAIGYTMVYGIIGMINFAHGEVYMIGSYIAFIAITLLAMMGL 65 ++L+ GLT GS YALIA+GYTMVYGII +INFAHGE+YMIG+++A I + + GL Sbjct: 3 YFLELFFGGLTRGSIYALIALGYTMVYGIIQLINFAHGEIYMIGAFVALIVAGVCTIYGL 62 Query: 66 DSVPLMMLAAFAASIIVTSAFGYSIERVAYRPLRGGNRLIPLISAIGMSIFLQNAVMLSQ 125 + +++LAA A +I SA+GY++E+VAYRPLRG RL PLISAIGMSIFLQN V+L+Q Sbjct: 63 SGISILILAAIIA-VIYASAYGYTLEKVAYRPLRGAPRLSPLISAIGMSIFLQNYVLLAQ 121 Query: 126 DSKEKAIPTLLPGNFVFGESSMNGVVISYMQILIFVVTFLVMFGLTLFISRSRLGRACRA 185 P L+P +F F E + +I +++I V T + M LTL I ++++G+A RA Sbjct: 122 TPDFLPFPRLIP-DFAFMEPVAH--IIGSPELVILVTTMVTMILLTLLIKKTKVGKAMRA 178 Query: 186 CAEDLKMTNLLGINSNNIIALTFVIGAALAAVAAVLLGMQYGVINPGIGFLAGIKAFTAA 245 +D+ M L+G+N + II+LTF+IG+ALAA+ VL+ G +N IGFLAG+KAFTAA Sbjct: 179 TQQDMDMARLVGVNVDRIISLTFIIGSALAAIGGVLVASYIGQVNFYIGFLAGVKAFTAA 238 Query: 246 VLGGIGSIPGAMLGGLLLGVAEAFGADVFGDQYKDVVAFGLLILVLLFRPTGILGRPEVE 305 VLGGIGSIPGA+LGGL+LG AE+F A Y+DV FGLL+L+L RP GILG+ + Sbjct: 239 VLGGIGSIPGAVLGGLVLGWAESFAAGYISSDYEDVFTFGLLVLILTLRPAGILGKARKQ 298 Query: 306 KV 307 KV Sbjct: 299 KV 300 Lambda K H 0.328 0.145 0.413 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 342 Number of extensions: 18 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 307 Length of database: 300 Length adjustment: 27 Effective length of query: 280 Effective length of database: 273 Effective search space: 76440 Effective search space used: 76440 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory