Align High-affinity branched-chain amino acid transport system permease protein BraD, component of Branched chain amino acid uptake transporter. Transports alanine (characterized)
to candidate WP_092349194.1 BLU87_RS12680 branched-chain amino acid ABC transporter permease
Query= TCDB::P21627 (307 letters) >NCBI__GCF_900107645.1:WP_092349194.1 Length = 298 Score = 250 bits (638), Expect = 3e-71 Identities = 132/301 (43%), Positives = 196/301 (65%), Gaps = 6/301 (1%) Query: 7 YLQQLVNGLTVGSTYALIAIGYTMVYGIIGMINFAHGEVYMIGSYIAFIAITLLAMMGLD 66 +LQQL NGLT+GS +AL+A+GYTMVYG++ +INFAHG++ +++ T ++G Sbjct: 4 FLQQLANGLTIGSMFALVALGYTMVYGVMKLINFAHGDMVAASAFVGLTIYT--QVLGQA 61 Query: 67 SVPLMMLAAFAASIIVTSAFGYSIERVAYRPLRGGNRLIPLISAIGMSIFLQNAVMLSQD 126 + + ++A F S +V + G +ER+AYRPLR RL ++SA+G S+ +QN +ML Sbjct: 62 TSLIAVIAIFLLSAMVMACVGILLERLAYRPLREAPRLSAVVSALGASLVIQNGIMLIWG 121 Query: 127 SKEKAIPTLLPGNFVFGESSMNGVVISYMQILIFVVTFLVMFGLTLFISRSRLGRACRAC 186 + + P L+P + + GVVIS +Q+LI V + ++M L LF+ ++R+G A RA Sbjct: 122 PQMRIFPELVPQVYW----DLGGVVISLIQVLILVFSLVLMIALYLFVEKTRMGAAIRAS 177 Query: 187 AEDLKMTNLLGINSNNIIALTFVIGAALAAVAAVLLGMQYGVINPGIGFLAGIKAFTAAV 246 A D L+GIN N++IAL F+IG++L AV + +G+ Y I +G+ G+ AF AA+ Sbjct: 178 AIDQDAARLMGINVNSVIALIFIIGSSLGAVGGLFIGLYYRGITFNMGWQYGLYAFIAAI 237 Query: 247 LGGIGSIPGAMLGGLLLGVAEAFGADVFGDQYKDVVAFGLLILVLLFRPTGILGRPEVEK 306 LGGIG+IPGAMLGG+LLG+ +AF A + D F LLIL+L+ RPTG+LG EK Sbjct: 238 LGGIGNIPGAMLGGMLLGLFQAFIAGYISSTWADAFTFILLILILIVRPTGLLGERVAEK 297 Query: 307 V 307 V Sbjct: 298 V 298 Lambda K H 0.328 0.145 0.413 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 313 Number of extensions: 14 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 307 Length of database: 298 Length adjustment: 27 Effective length of query: 280 Effective length of database: 271 Effective search space: 75880 Effective search space used: 75880 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory