Align spermidine/putrescine ABC transporter, periplasmic spermidine/putrescine-binding protein PotD (characterized)
to candidate WP_092349409.1 BLU87_RS13060 spermidine/putrescine ABC transporter substrate-binding protein
Query= CharProtDB::CH_088339 (348 letters) >NCBI__GCF_900107645.1:WP_092349409.1 Length = 352 Score = 128 bits (322), Expect = 2e-34 Identities = 114/364 (31%), Positives = 167/364 (45%), Gaps = 28/364 (7%) Query: 1 MKKWSRHLLAAGALALGMSAAHADDNNTLYFYNWTEYVPPGLLEQFTKETGIKVIYSTYE 60 MKK + L A G S A TL W Y P L+++F KETGIKV TY Sbjct: 1 MKKVALVTLFAVFFLAGFSQAE-----TLSLLTWKGYAPQALVDKFEKETGIKVEV-TYS 54 Query: 61 SNETMYAKLKTYKDGAYDLVVPSTYYVDKMRKEGMI-QKIDKSKLTNFSNLDPDMLN--- 116 +NE M AKL+ + +DL PS + ++++ I Q +D SK+ + P MLN Sbjct: 55 NNEEMIAKLRATRGAGFDLAQPSQDRISSVQEKYKIYQAMDYSKI-DADLFIPSMLNAVK 113 Query: 117 KPFDPNND-YSIPYIWGATAIGVNGDAVDPKSVTSWADLWKPEYKGSLLLTDDAREVFQM 175 K D ++ P+ WG + + VN + V SW L +Y G + + M Sbjct: 114 KNTQVGGDSFAAPFCWGTSGMIVN--SAKAPGVNSWKALLDDKYTGRVSYRLKRPTLIAM 171 Query: 176 ALRKLGYSGNT--TDPKEIEAAYNEL-------KKLMPNVAAFNSDNPANPYMEGEVNLG 226 LGY +D +A +++ K L+ N A N D EV + Sbjct: 172 GFA-LGYDPFALYSDATAYKAMLDKIAETLMAAKPLVKNYWA-NGDALLESMRSEEVFIA 229 Query: 227 MIWNGSAFVARQAGTPIDVVWPKEGGIFWMDSLAIPANAKNKEGALKLINFLLRPDVAKQ 286 M W+ + ID V P+EG + W+D+ AIP+ AKN + A K INF+L+P+ A Sbjct: 230 MAWDAGGWKLHDNNAAIDFVAPQEGALGWIDTFAIPSKAKNLDAAYKWINFMLKPENAGY 289 Query: 287 VAETIGYPTPNLAARKLLSPEVAND-KTLYPDAETIKNGEWQNDVGAASSIYE-EYYQKL 344 T Y T + A + +SPEV N+ + +P A I N +W V A E + K+ Sbjct: 290 FTTTEKYGTASQGANEFISPEVRNNFERTFPQA-AIDNIKWYPPVPAQLERMEGKILDKV 348 Query: 345 KAGR 348 KA + Sbjct: 349 KAAK 352 Lambda K H 0.314 0.132 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 330 Number of extensions: 18 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 348 Length of database: 352 Length adjustment: 29 Effective length of query: 319 Effective length of database: 323 Effective search space: 103037 Effective search space used: 103037 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory