Align 3-hydroxybutyryl-CoA dehydratase; EC 4.2.1.55 (characterized)
to candidate WP_092349958.1 BLU87_RS14160 hypothetical protein
Query= CharProtDB::CH_091794 (261 letters) >NCBI__GCF_900107645.1:WP_092349958.1 Length = 250 Score = 114 bits (285), Expect = 2e-30 Identities = 79/257 (30%), Positives = 121/257 (47%), Gaps = 16/257 (6%) Query: 5 NVILEKEGKVAVVTINRPKALNALNSDTLKEMDYVIGEIENDSEVLAVILTGAGEKSFVA 64 ++I K + +NR + NAL ++ + I + D + A IL G E F + Sbjct: 4 HIITSKINSAYCIQLNRSEKKNALTAEMYTAIAEGIQHADADDSISATILYGV-EGCFTS 62 Query: 65 GADISEMKEMNTIEGRKFGILGNKVFRR------LELLEKPVIAAVNGFALGGGCEIAMS 118 G D+S G + G N+++ L KPVIA V+G LG G + Sbjct: 63 GNDLS---------GFRNGPAANRIYPHNIYIDALRHARKPVIAVVDGICLGIGTIMLFH 113 Query: 119 CDIRIASSNARFGQPEVGLGITPGFGGTQRLSRLVGMGMAKQLIFTAQNIKADEALRIGL 178 CD S RF P V LG++P G + L L+G A ++I + A+ A RIGL Sbjct: 114 CDFVYVSPQTRFSLPFVNLGLSPEGGTSYILPHLIGYQKAAEIILLGEPFGAELAERIGL 173 Query: 179 VNKVVEPSELMNTAKEIANKIVSNAPVAVKLSKQAINRGMQCDIDTALAFESEAFGECFS 238 VN++V LM A ++ K+ S AV +K + RGM + TALA E + F E Sbjct: 174 VNEIVASDGLMGRALDVVEKLASKNLQAVLAAKALLKRGMDDAVTTALARELDLFNERME 233 Query: 239 TEDQKDAMTAFIEKRKI 255 T + ++ + +F K++I Sbjct: 234 TPEVRETINSFFNKKRI 250 Lambda K H 0.317 0.134 0.365 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 147 Number of extensions: 8 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 261 Length of database: 250 Length adjustment: 24 Effective length of query: 237 Effective length of database: 226 Effective search space: 53562 Effective search space used: 53562 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory